MFSD6 Antibody

Images

 
Western Blot: MFSD6 Antibody [NBP2-85275] - Host: Rabbit. Target Name: MFSD6. Sample Tissue: A172 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFSD6 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human MFSD6. Peptide sequence: DDKVAILTDDEEEQKRKYVLADPFNGISREPEPPSNETPSSTETSAIPEE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
MFSD6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MFSD6 Antibody

  • hMMR2
  • Macrophage MHC class I receptor 2 homolog
  • macrophage MHC receptor 2
  • major facilitator superfamily domain containing 6
  • major facilitator superfamily domain-containing protein 6
  • MMR2FLJ20160

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2535
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
NLS4229
Species: Hu
Applications: ICC, ICC/IF, IHC, IHC-P
H00374868-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
MAB140
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
NBP3-17255
Species: Hu
Applications: ICC/IF, WB
NBP1-59069
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB110-8146
Species: Bv, Fe, Hu, Po
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IM, WB
NBP2-02673
Species: Ca, Hu
Applications: Flow, IHC, IHC-P, WB
NBP1-89766
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF-241-NA
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut, WB
NBP2-85275
Species: Hu
Applications: WB

Publications for MFSD6 Antibody (NBP2-85275) (0)

There are no publications for MFSD6 Antibody (NBP2-85275).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFSD6 Antibody (NBP2-85275) (0)

There are no reviews for MFSD6 Antibody (NBP2-85275). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MFSD6 Antibody (NBP2-85275) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MFSD6 Products

Array NBP2-85275

Bioinformatics Tool for MFSD6 Antibody (NBP2-85275)

Discover related pathways, diseases and genes to MFSD6 Antibody (NBP2-85275). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFSD6 Antibody (NBP2-85275)

Discover more about diseases related to MFSD6 Antibody (NBP2-85275).
 

Pathways for MFSD6 Antibody (NBP2-85275)

View related products by pathway.

Blogs on MFSD6

There are no specific blogs for MFSD6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFSD6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFSD6