Home » MFNG » MFNG Peptides and Proteins » MFNG Recombinant Protein Antigen

MFNG Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MFNG Protein (NBP2-14234PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

MFNG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFNG.

Source: E.coli

Amino Acid Sequence: TTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALSCKMAAEFDTFLAS
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MFNG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-14234.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MFNG Recombinant Protein Antigen

  • beta-1,3-N-acetylglucosaminyltransferase manic fringe
  • EC 2.4.1.222
  • manic fringe (Drosophila) homolog
  • manic fringe homolog (Drosophila)
  • MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  • MFNG
  • O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Lunatic Fringe
Antibody
NBP2-39097
Western Blot: Lunatic Fringe Antibody [NBP2-39097] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: Lunatic Fringe Antibody [NBP2-39097] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
RFNG Antibody
NBP1-90946
Western Blot: RFNG Antibody [NBP1-90946] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: RFNG Antibody [NBP1-90946] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus.
Immunohistochemistry-Paraffin: RFNG Antibody [NBP1-90946] - Staining of human kidney shows cytoplasmic, nuclaer and membranous positivity.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Lunatic Fringe
Antibody
NBP2-39097
Western Blot: Lunatic Fringe Antibody [NBP2-39097] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: Lunatic Fringe Antibody [NBP2-39097] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Species: Hu
Applications: WB, IHC, IHC-P
Neurogenin-3
Antibody
AF3444
Western blot shows lysates of human placenta and prostate tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Neurogenin‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3444) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Neurogenin‑3 at approximately 25 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(5 Publications)
Species: Hu
Applications: WB
DLL1 Antibody
[Unconjugated]
AF3970
DLL1 was detected in immersion fixed frozen sections of embryonic mouse stomach (E13.5) using 10 µg/mL Sheep Anti-Mouse/Rat DLL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3970) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Mouse splenocytes were stained with Sheep Anti-Mouse/Rat DLL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3970, filled histogram) or control antibody (Catalog # 5-001-A, open histogram), followed by NorthernLights™ 637-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # NL011).
(3 Publications)
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
Notch-1 Antibody
(mN1A)
NB100-78486
Knockout Validated: Notch-1 Antibody (mN1A) [NB100-78486] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and Notch-1 knockout (KO) HeLa cell line. PVDF membrane was probed with 2.0 ug/mL of Mouse Anti-Human Notch-1 Monoclonal Antibody (Catalog # NB100-78486) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for Notch-1 at approximately 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: Notch-1 Antibody (mN1A) [NB100-78486] - Cell extracts from Jurkat (Lane 1) or mouse thymocytes (Lane 2) were Western Blot analyzed with monoclonal anti-NOTCH1 antibody. The mN1A antibody recognizes both mouse and human 270 kD full-length NOTCH1 and 110-120 kD cleaved NOTCH 1 (NICD).
Immunocytochemistry/Immunofluorescence: Notch-1 Antibody (mN1A) [NB100-78486] - The Notch1 Antibody was tested in HEK293 cells at a 1:50 dilution against Dylight 488 (Green). Actin was counterstained against Phalloidin 568 (Red) and cells were mounted in DAPI Flouromount (Blue).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Notch-2 Antibody
NBP2-27347
Western Blot: Notch-2 Antibody [NBP2-27347] - Analysis of NOTCH2 in human brain lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27347 at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Species: Hu
Applications: WB
Jagged 1
[Unconjugated]
1277-JG
Jagged 1 [Unconjugated]
(1 Review)
(20 Publications)
Species: Hu
EWSR1 Antibody
NBP2-16389
Western Blot: EWSR1 Antibody [NBP2-16389] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with EWSR1 antibody diluted at a dilution of 1:1000.
Immunocytochemistry/Immunofluorescence: EWSR1 Antibody [NBP2-16389] - Analysis of paraformaldehyde-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: EWSR1 Antibody [NBP2-16389] - Paraffin-embedded mouse duodenum. EWSR1 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(11 Reviews)
(326 Publications)
Species: Hu
ARS2 Antibody
NBP2-13382
Western Blot: ARS2 Antibody [NBP2-13382] - Analysis in MCF-7 cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Immunocytochemistry/Immunofluorescence: ARS2 Antibody [NBP2-13382] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARS2 Antibody [NBP2-13382] - Immunohistochemical staining of human colon shows strong nuclear positivity in glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Protein
O-Fucosyltransferase ...
NBP2-19882
Western Blot: POFUT1 Antibody [NBP2-19882] - Sample (50 ug of whole cell lysate) A: Mouse Liver, 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: POFUT1 Antibody [NBP2-19882] - Immunofluorescence analysis of methanol-fixed HCT116, using antibody at 1:500 dilution.
Western Blot: POFUT1 Antibody [NBP2-19882] - Sample (15 ug of whole cell lysate) A: HUVEC 12% SDS PAGE gel, diluted at 1:5000.
Species: Hu, Mu
Applications: WB, ICC/IF
HES-1 Antibody
(OTI4H1)
NBP1-47791
Western Blot: HES-1 Antibody (4H1) [NBP1-47791] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Hes1(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Hes1.
Immunocytochemistry/Immunofluorescence: HES-1 Antibody (4H1) [NBP1-47791] - HeLa cells using anti-HES1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: HES-1 Antibody (4H1) [NBP1-47791] - Staining of paraffin-embedded liver using anti-Hes1 mouse monoclonal antibody.
(5 Publications)
Species: Hu, Mk
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
C21orf33 Antibody
(1F5)
H00008209-M01
Western Blot: C21orf33 Antibody (1F5) [H00008209-M01] - C21orf33 monoclonal antibody (M01), clone 1F5 Analysis of C21orf33 expression in HeLa.
Immunocytochemistry/Immunofluorescence: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: C21orf33 Antibody (1F5) [H00008209-M01] - Analysis of monoclonal antibody to C21orf33 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
csl/RBPJK Antibody
NBP1-33427
Western Blot: csl/RBPJK Antibody [NBP1-33427] - Sample (30 ug of whole cell lysate) A: Raji 7.5% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: csl/RBPJK Antibody [NBP1-33427] - Analysis of paraformaldehyde-fixed HeLa at 1:100 dilution.
Chromatin Immunoprecipitation (ChIP): csl/RBPJK Antibody [NBP1-33427] - Sheared, cross-linked chromatin was prepared from Jurkat T-ALL cells using the Covaris TruChIP kit and shearing with the LE220 sonicator. The chromatin buffer was adjusted to 150 mM NaCl, 20 mM Tris-Cl pH 8, 2 mM EDTA, and 1% Triton X-100. Three antibodies, as well as pure pre-immune rabbit IgG control, were added to each IP reaction, consisting of 7 million cells, and incubated overnight with mixing at 4 C. The antibodies were captured with Magna ChIP Protein A+G beads (Millipore), washed with three wash buffers, and the DNA eluted and purified with the iPure v2 kit (Diagenode). The purified DNA was normalized to the input control with qPCR quantification of the insulin exon 1 gene (INS) and an RBPJ binding site in the promoter of HES1. Image from verified customer review.
(1 Review)
Species: Hu
Applications: WB, ICC/IF, ChIP
Flightless I
Antibody
NBP1-87926
Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Osteopontin/OPN
Antibody [Unconjugate
AF808
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN was detected in perfusion fixed frozen sections of mouse thymus using Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Reviews)
(56 Publications)
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MFNG Recombinant
Protein Antigen
NBP2-14234PEP
MFNG Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MFNG Protein (NBP2-14234PEP) (0)

There are no publications for MFNG Protein (NBP2-14234PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MFNG Protein (NBP2-14234PEP) (0)

There are no reviews for MFNG Protein (NBP2-14234PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MFNG Protein (NBP2-14234PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MFNG Protein (NBP2-14234PEP)

Discover related pathways, diseases and genes to MFNG Protein (NBP2-14234PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MFNG Protein (NBP2-14234PEP)

Discover more about diseases related to MFNG Protein (NBP2-14234PEP).
 

Pathways for MFNG Protein (NBP2-14234PEP)

View related products by pathway.

PTMs for MFNG Protein (NBP2-14234PEP)

Learn more about PTMs related to MFNG Protein (NBP2-14234PEP).

Blogs on MFNG

There are no specific blogs for MFNG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

12.5% SDS-PAGE Stained with Coomassie Blue.
Recombinant Human MFNG Protein
H00004242-P01-10ug
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
EGF [Unconjugated]
236-EG-200
Western blot shows lysates of human pancreas tissue. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human MFNG Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6355) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for MFNG at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
MFNG Antibody
AF6355
Recombinant Mouse Osteopontin/OPN (Catalog # 441-OP), immobilized onto a microplate, supports the adhesion of the HEK293 human embryonic kidney cell line in a dose-dependent manner (orange line). Adhesion elicited by Recombinant Mouse Osteopontin/OPN (2 µg/mL) is neutralized (green line) by increasing concentrations of Mouse Osteopontin/OPN Antigen Affinity-purified Polyclonal Antibody (Catalog # AF808). The ND50 is typically 1‑3 µg/mL.
Osteopontin/OPN Antibody [Unconjugated]
AF808

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MFNG Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MFNG