![Immunohistochemistry: METTL14 Antibody [NBP3-38559] - Immunohistochemistry analysis of paraffin-embedded Human colon using METTL14 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38559_rabbit-mettl14-pab-1012202411343398.jpg "Immunohistochemistry: METTL14 Antibody [NBP3-38559] - Immunohistochemistry analysis of paraffin-embedded Human colon using METTL14 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit METTL14 Antibody - BSA Free (NBP3-38559) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human METTL14 (NP_066012.1). Sequence: MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | METTL14 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 52 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for METTL14 Antibody (NBP3-38559)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | METTL14 |
![Immunohistochemistry: METTL14 Antibody [NBP3-38559] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using METTL14 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-38559_rabbit-mettl14-pab-1012202411421027.jpg "Immunohistochemistry: METTL14 Antibody [NBP3-38559] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using METTL14 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.")
![Western Blot: METTL14 Antibody [NBP3-38559] - Western blot analysis of various lysates, using METTL14 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.](http://images.novusbio.com/fullsize/nbp3-38559_rabbit-mettl14-pab-101220241138120.jpg "Western Blot: METTL14 Antibody [NBP3-38559] - Western blot analysis of various lysates, using METTL14 Rabbit pAb at 1:500 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.")
![Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] - Immunofluorescence analysis of Human colon cancer tissue using METTL14 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-38559_rabbit-mettl14-pab-31120251704744.jpg "Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] - Immunofluorescence analysis of Human colon cancer tissue using METTL14 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining. High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.")
![Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] - Immunofluorescence analysis of Mouse brain tissue using METTL14 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining. Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.](http://images.novusbio.com/fullsize/nbp3-38559_rabbit-mettl14-pab-31120251704774.jpg "Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP3-38559] - Immunofluorescence analysis of Mouse brain tissue using METTL14 Rabbit pAb at a dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L)at 1:500 dilution. Blue: DAPI for nuclear staining. Microwave antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining.")
![Simple Western KLF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF5_AF3758_Simple_Western_17008.jpg)
![Knockout Validated KLF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF5_AF3758_Knockout_Validated_22484.jpg)
![Immunocytochemistry KLF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF5_AF3758_Immunocytochemistry_12361.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")