METTL1 Antibody

Images

 
Western Blot: METTL1 Antibody [NBP1-88386] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: METTL1 Antibody [NBP1-88386] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: METTL1 Antibody [NBP1-88386] - Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

METTL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
METTL1 Protein (NBP1-88386PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (84%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for METTL1 Antibody

  • C12orf1
  • D1075-like gene product
  • EC 2.1.1.33
  • FLJ95748
  • methyltransferase like 1
  • methyltransferase-like 1
  • Methyltransferase-like protein 1
  • TRM8
  • tRNA (guanine-N(7)-)-methyltransferase
  • tRNA(m7G46)-methyltransferase
  • YDL201w

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86901
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-2383
Species: Hu
Applications: WB, ICC/IF
MAB79671
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52555
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF1518
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-14036
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88386
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for METTL1 Antibody (NBP1-88386) (0)

There are no publications for METTL1 Antibody (NBP1-88386).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for METTL1 Antibody (NBP1-88386) (0)

There are no reviews for METTL1 Antibody (NBP1-88386). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for METTL1 Antibody (NBP1-88386) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional METTL1 Products

Bioinformatics Tool for METTL1 Antibody (NBP1-88386)

Discover related pathways, diseases and genes to METTL1 Antibody (NBP1-88386). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for METTL1 Antibody (NBP1-88386)

Discover more about diseases related to METTL1 Antibody (NBP1-88386).
 

Pathways for METTL1 Antibody (NBP1-88386)

View related products by pathway.

PTMs for METTL1 Antibody (NBP1-88386)

Learn more about PTMs related to METTL1 Antibody (NBP1-88386).

Blogs on METTL1

There are no specific blogs for METTL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL1