METTL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: METTL1 Antibody [NBP1-88386] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.

Staining of human skin shows moderate nuclear positivity in squamous epithelial cells.

Staining of human skeletal muscle shows no nuclear positivity in myocytes as expected.

Staining of human cerebral cortex shows no nuclear positivity in neuronal cells as expected.

Staining of human urinary bladder shows strong nuclear positivity in urothelial cells.

Staining of human pancreas shows moderate nuclear positivity in exocrine glandular cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

METTL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit METTL1 Antibody - BSA Free (NBP1-88386) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: METTL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  METTL1 Protein (NBP1-88386PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for METTL1 Antibody - BSA Free

• C12orf1
• D1075-like gene product
• EC 2.1.1.33
• FLJ95748
• methyltransferase like 1
• methyltransferase-like 1
• Methyltransferase-like protein 1
• TRM8
• tRNA (guanine-N(7)-)-methyltransferase
• tRNA(m7G46)-methyltransferase
• YDL201w

Background

METTL1 is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: METTL1