![Western Blot: METT10D Antibody [NBP1-81239] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/METT10D-Antibody-Western-Blot-NBP1-81239-img0009.jpg "Western Blot: METT10D Antibody [NBP1-81239] - Analysis in Caco-2 cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DERSEEKGGVEVLESCQGSSNGAQDQEASEQFGSPVAERGKRLPGVAGQYLFKCLINVKKEVDDALVEMHWVE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | METTL16 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | METTL16 |
![Immunocytochemistry/Immunofluorescence: METT10D Antibody [NBP1-81239] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/METT10D-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-81239-img0006.jpg "Immunocytochemistry/Immunofluorescence: METT10D Antibody [NBP1-81239] - Staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Immunohistochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Immunohistochemistry_15873.jpg)
![Immunocytochemistry Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin-13_AF3264_Immunocytochemistry_6491.jpg)
![Simple Western Cadherin-13 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cadherin13_AF3264_Simple_Western_17005.jpg)
![Western Blot WDR5 Antibody [Unconjugated]](https://images.novusbio.com/images2/WDR5_AF5810_Western_Blot_5854.jpg)
![Immunohistochemistry WDR5 Antibody [Unconjugated]](https://images.novusbio.com/images2/WDR5_AF5810_Immunohistochemistry_21711.jpg)
![Immunocytochemistry/ Immunofluorescence WDR5 Antibody [Unconjugated]](https://images.novusbio.com/images/af5810_human-mouse-wdr5-affinity-purified-polyclonal-ab-41202412401254.jpg)
![Norrin/NDP Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Norrin/NDP Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")