Methyltransferase like 3 Antibody - Azide and BSA Free

Western Blot: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Western blot analysis of lysates from wild type (WT) and Methyltransferase like 3 knockdown (KD) 293T cells using Methyltransferase like 3 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunofluorescence analysis of PC-3 cells using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunofluorescence analysis of HepG2 cells using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunohistochemistry analysis of paraffin-embedded Mouse testis using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Western blot analysis of various lysates using Methyltransferase like 3 Rabbit pAb at 1:1000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Confocal immunofluorescence analysis of Hela cells using Methyltransferase like 3 Rabbit pAb at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunohistochemistry: Methyltransferase like 3 Antibody - Azide and BSA Free [Methyltransferase like 3] - Immunohistochemistry analysis of paraffin-embedded Human lung cancer using Methyltransferase like 3 Rabbit pAb at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Methyltransferase like 3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Methyltransferase like 3 Antibody - Azide and BSA Free (NBP3-03290) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Methyltransferase like 3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human Methyltransferase like 3 (NP_062826.2). MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDSPVPTAPTSGGPKPSTASAVPELATDPELEKKLLHHLSDLALTLPTDAVSICLAISTPDAPATQDGVESLLQKFAAQELIEVKRGLLQDDAHPTLVTYADHSKLSAM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: METTL3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Methyltransferase like 3 Antibody - Azide and BSA Free

• adoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase
• EC 2.1.1.62
• IME4
• M6A
• methyltransferase like 3
• Methyltransferase-like protein 3
• MGC4336
• mRNA m(6)A methyltransferase
• MTA70
• MT-A70
• N6-adenosine-methyltransferase 70 kDa subunit
• Spo8

Background

Methyltransferase like 3 encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Methyltransferase like 3 Antibody (NBP3-03290)(1)

Publication using NBP3-03290

• Lv D, Zhong C, Dixit D et al. EGFR promotes ALKBH5 nuclear retention to attenuate N6-methyladenosine and protect against ferroptosis in glioblastoma Molecular cell 2023-11-08 [PMID: 37979586]

Bioinformatics

• Gene Symbol: METTL3