Methionine Sulfoxide Reductase B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Methionine Sulfoxide Reductase B Antibody [NBP2-58741] - Staining of human cell line MCF7 shows localization to nucleoplasm.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Methionine Sulfoxide Reductase B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Methionine Sulfoxide Reductase B Antibody - BSA Free (NBP2-58741) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVQMWETGQVSCTGSRTKVNLLCRRSAWEMGVWEETPSASPSKGLHCGCIMARSSPSCLVIFPGVLWQVWQWVGPRVPERRPQAGAVPILNIQQLAEVCP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MSRB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Methionine Sulfoxide Reductase B Recombinant Protein Antigen (NBP2-58741PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Methionine Sulfoxide Reductase B Antibody - BSA Free

• EC 1.8.4.-
• methionine sulfoxide reductase
• methionine-R-sulfoxide reductase B1
• MGC3344
• MsrB1
• MSRB1selenoprotein R
• Selenoprotein X
• selenoprotein X, 1
• SELR
• SELX

Background

Methionine Sulfoxide Reductase B encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This protein belongs to the methionine sulfoxide reductase B (MsrB) family, and it is expressed in a variety of adult and fetal tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MSRB1