Methionine Aminopeptidase 1/METAP1 Antibody

Images

 
Western Blot: Methionine Aminopeptidase 1/METAP1 Antibody [NBP1-53088] - Sample Type: Human Testis Antibody Dilution: 1.0 ug/ml
Western Blot: Methionine Aminopeptidase 1/METAP1 Antibody [NBP1-53088] - COLO205 cells lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Methionine Aminopeptidase 1/METAP1 Antibody Summary

Immunogen
Synthetic peptides corresponding to METAP1(methionyl aminopeptidase 1) The peptide sequence was selected from the N terminal of METAP1. Peptide sequence GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQ.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against METAP1 and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Methionine Aminopeptidase 1/METAP1 Antibody

  • DKFZp781C0419
  • EC 3.4.11.18
  • KIAA0094MAP 1
  • MAP1
  • MAP1A
  • MetAP 1
  • MetAP1
  • MetAP1A
  • Methionine Aminopeptidase 1
  • methionyl aminopeptidase 1
  • Peptidase M 1

Background

METAP1 removes the amino-terminal methionine from nascent proteins. METAP1 is required for normal progression through the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3795
Species: Hu
Applications: WB, IP
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-31528
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89575
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF1724
Species: Hu
Applications: WB, IP
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47383
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
H00010411-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-24449
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088) (0)

There are no publications for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088) (0)

There are no reviews for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Methionine Aminopeptidase 1/METAP1 Products

Bioinformatics Tool for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088)

Discover related pathways, diseases and genes to Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088)

Discover more about diseases related to Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088).
 

Pathways for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088)

View related products by pathway.

PTMs for Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088)

Learn more about PTMs related to Methionine Aminopeptidase 1/METAP1 Antibody (NBP1-53088).

Blogs on Methionine Aminopeptidase 1/METAP1

There are no specific blogs for Methionine Aminopeptidase 1/METAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Methionine Aminopeptidase 1/METAP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METAP1
Entrez