Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 296-350 of Human Melatonin R1A/MT1/MTNR1A

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MTNR1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
31.79 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein

  • Mel1a receptor
  • Mel-1A-R
  • Melatonin R1A
  • melatonin receptor 1A
  • melatonin receptor type 1A
  • MelatoninR1A
  • MT1
  • MTNR1A

Background

MTNR1A - melatonin receptor 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS932
Species: Ch, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KD, WB
H00004502-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP2-67415
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00027349-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
NBP1-89772
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
7268-CT
Species: Hu
Applications: BA
DTM100
Species: Hu
Applications: ELISA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
DMP900
Species: Hu
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DTM200
Species: Hu
Applications: ELISA
NBP2-43801
Species: Hu, Mu, Rt
Applications: WB
NB120-3439
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NB600-1160
Species: Bv, Ca, Hu, Mu, Po, Rt, Ze
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NB100-77417
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, WB
H00009248-B01P
Species: Hu, Mu, Rt
Applications: Flow, KO, WB
H00004543-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01) (0)

There are no publications for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01) (0)

There are no reviews for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01). (Showing 1 - 2 of 2 FAQ).

  1. I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.
    • At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.
  2. Do you have MTNR1A polyclonal antibody ?
    • Here are our MTNR1A antibodies that are polyclonal

Additional Melatonin R1A/MT1/MTNR1A Products

Bioinformatics Tool for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)

Discover related pathways, diseases and genes to Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)

Discover more about diseases related to Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01).
 

Pathways for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)

View related products by pathway.

PTMs for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)

Learn more about PTMs related to Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01).
 

Research Areas for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)

Find related products by research area.

Blogs on Melatonin R1A/MT1/MTNR1A

There are no specific blogs for Melatonin R1A/MT1/MTNR1A, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MTNR1A