Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, MA, AP

Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 296-350 of Human Melatonin R1A/MT1/MTNR1A
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: GLLNQNFRKEYRRIIVSLCTARVFFVDSSNDVADRVKWKPSPLMTNNNVVKVDSV

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: MTNR1A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 31.79 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Melatonin R1A/MT1/MTNR1A GST (N-Term) Protein

• Mel1a receptor
• Mel-1A-R
• Melatonin R1A
• melatonin receptor 1A
• melatonin receptor type 1A
• MelatoninR1A
• MT1
• MTNR1A

Background

MTNR1A - melatonin receptor 1A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01)(1)

Publication using H00004543-Q01

• Ryu Vitaly, Zarebidaki Eleen, Albers H Elliott et al. Short photoperiod reverses obesity in Siberian hamsters via sympathetically induced lipolysis and Browning in adipose tissue. Physiology & Behavior 2017-07-08 [PMID: 28694154]

FAQs for Melatonin R1A/MT1/MTNR1A Partial Recombinant Protein (H00004543-Q01). (Showing 1 - 2 of 2 FAQ).

1. I saw that you have the antibodies for the both receptors of melatonin but not listed with FACS application. I need more information about what is better for my assay.
   • At this time, none of our melatonin receptor antibodies have been tested and validated in Flow. Should you choose to purchase and test one of them, you would qualify for the Innovator's Rewards program. You should take a look at each individual antibody, the clonality, conjugates, immunogen region and all relevant data in order to decide which product would be most suitable for your needs.
2. Do you have MTNR1A polyclonal antibody ?
   • Here are our MTNR1A antibodies that are polyclonal

Bioinformatics

• Gene Symbol: MTNR1A