Melanotransferrin/CD228/MFI2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

Melanotransferrin/CD228/MFI2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MFI2.
  
  

  Source: E. coli

  Amino Acid Sequence: RSEDYELLCPNGARAEVSQFAACNLAQIPPHAVMVRPDTNIFTVYGLLDKAQDLFGDDHNKNGFKMFDSSNYHGQDLLFKDATVRAVPVGEKTTYRGWLGLDYVAALEGMSSQQC

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MELTF
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85777.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 30 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Melanotransferrin/CD228/MFI2 Recombinant Protein Antigen

• antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and96.5
• CD228 antigen
• CD228
• FLJ38863
• MAP97
• MAP97Melanoma-associated antigen p97
• Melanotransferrin
• membrane-bound transferrin-like protein
• MFI2
• MGC4856
• MTF
• MTF1
• p97

Background

MFI2 is encoded by this gene is a cell-surface glycoprotein found on melanoma cells. The protein shares sequence similarity and iron-binding properties with members of the transferrin superfamily. The importance of the iron binding function has not yet been identified. This gene resides in the same region of chromosome 3 as members of the transferrin superfamily. Alternative splicing results in two transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Melanotransferrin/CD228/MFI2 Protein (NBP1-85777PEP)(1)

Publication using NBP1-85777PEP

• Sawaki K, Kanda M, Umeda S et al. Level of Melanotransferrin in Tissue and Sera Serves as a Prognostic Marker of Gastric Cancer Anticancer Res. 2019-11-01 [PMID: 31704840]

Bioinformatics

• Gene Symbol: MELTF