MEKK4 Antibody (6A12)

Images

 
ELISA: MEKK4 Antibody (6A12) [H00004216-M06] - Detection limit for recombinant GST tagged MAP3K4 is approximately 0.1ng/ml as a capture antibody.
Proximity Ligation Assay: MEKK4 Antibody (6A12) [H00004216-M06] - Analysis of protein-protein interactions between MAP2K3 and MAP3K4 HeLa cells were stained with anti-MAP2K3 rabbit purified polyclonal 1:1200 and ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA
Clone
6A12
Clonality
Monoclonal
Host
Mouse

Order Details

MEKK4 Antibody (6A12) Summary

Immunogen
MAP3K4 (NP_005913, 1201 a.a. ~ 1300 a.a) partial recombinant protein with GST tag.AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAEL QFRSLSRHSSPTEERDEPAYPRGDSSGSTRRSWELRTLISQS KDTASKLGPIEAIQKS
Specificity
MAP3K4 - mitogen-activated protein kinase kinase kinase 4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MAP3K4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Proximity Ligation Assay
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Other species not tested.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MEKK4 Antibody (6A12)

  • EC 2.7.11.25
  • FLJ42439
  • MAPKKK4yeast, homolog of
  • MEKK 4
  • mitogen-activated protein kinase kinase kinase 4

Background

The central core of each mitogen-activated protein kinase (MAPK) pathway is a conserved cascade of 3 protein kinases: an activated MAPK kinase kinase (MAPKKK) phosphorylates and activates a specific MAPK kinase (MAPKK), which then activates a specific MAPK. While the ERK MAPKs are activated by mitogenic stimulation, the CSBP2 and JNK MAPKs are activated by environmental stresses such as osmotic shock, UV irradiation, wound stress, and inflammatory factors. This gene encodes a MAPKKK, the MEKK4 protein, also called MTK1. This protein contains a protein kinase catalytic domain at the C terminus. The N-terminal nonkinase domain may contain a regulatory domain. Expression of MEKK4 in mammalian cells activated the CSBP2 and JNK MAPK pathways, but not the ERK pathway. In vitro kinase studies indicated that recombinant MEKK4 can specifically phosphorylate and activate PRKMK6 and SERK1, MAPKKs that activate CSBP2 and JNK, respectively but cannot phosphorylate PRKMK1, an MAPKK that activates ERKs. MEKK4 is a major mediator of environmental stresses that activate the CSBP2 MAPK pathway, and a minor mediator of the JNK pathway. Two alternatively spliced transcripts encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1925
Species: Ce, Hu(-), Ma(-), Mu(-), Rt(-)
Applications: WB, ELISA, IHC, IHC-P
NBP1-47842
Species: Hu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P, IP
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-44405
Species: Hu
Applications: WB, Flow, IHC-P, IF
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82048
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
MAB8930
Species: Hu
Applications: WB, Simple Western, ICC
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
MAB8407
Species: Hu, Mu, Rt
Applications: WB
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45807
Species: Hu
Applications: WB, IHC, IF
NBP2-33875
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MEKK4 Antibody (H00004216-M06) (0)

There are no publications for MEKK4 Antibody (H00004216-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEKK4 Antibody (H00004216-M06) (0)

There are no reviews for MEKK4 Antibody (H00004216-M06). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEKK4 Antibody (H00004216-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MEKK4 Antibody (6A12) Products

Related Products by Gene

Bioinformatics Tool for MEKK4 Antibody (H00004216-M06)

Discover related pathways, diseases and genes to MEKK4 Antibody (H00004216-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEKK4 Antibody (H00004216-M06)

Discover more about diseases related to MEKK4 Antibody (H00004216-M06).
 

Pathways for MEKK4 Antibody (H00004216-M06)

View related products by pathway.

PTMs for MEKK4 Antibody (H00004216-M06)

Learn more about PTMs related to MEKK4 Antibody (H00004216-M06).
 

Research Areas for MEKK4 Antibody (H00004216-M06)

Find related products by research area.

Blogs on MEKK4

There are no specific blogs for MEKK4, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MAP3K4
Entrez
OMIM
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00004216-M06 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought