MEKK1 Antibody - Azide and BSA Free

Knockout Validated: MEKK1 Antibody [NBP3-02961] - Analysis of extracts from normal (control) and MAP3K1 knockout (KO) HeLa cells, using MEKK1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Product Discontinued

MEKK1 Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1400 to the C-terminus of human MEKK1 (NP_005912.1). TGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMACAKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLKHPVFRTTW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP3K1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 164 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS with 50% glycerol, pH7.3.
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MEKK1 Antibody - Azide and BSA Free

• Map3k1
• MAPK/ERK kinase kinase 1
• MAPKKK1MAP/ERK kinase kinase 1
• MEK kinase 1
• MEKK1EC 2.7.11.25
• MEKKMEKK 1
• mitogen-activated protein kinase kinase kinase 1

Background

MEKKs (Mitogen activated protein kinase kinase kinases) are serine-threonine kinases that act as the first tier of cellular MAP kinase pathways by activation of MAP/ERK kinases, or MEKs. Many enzymes with MEKK activity have been identified, including MEKK1-4, Raf, MLK3, TAK, and DLK. MEKKs generally display little similarity outside of their catalytic kinase domains. MEKK1-4 are nearly 50% identical within their catalytic domains, and are known to regulate Erk, Jnk, and p38 MAP kinase pathways. MEKK2 and MEKK3 bind MEK5 via conserved PB1 domains, leading to downstream activation of Erk5.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAP3K1