Meis homeobox 3 Antibody - Azide and BSA Free

Western Blot: Meis homeobox 3 Antibody [H00056917-B01P] - Analysis of MEIS3 expression in transfected 293T cell line by MEIS3 polyclonal antibody. Lane 1: MEIS3 transfected lysate(46.31 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Meis homeobox 3 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse Meis homeobox 3 Antibody - Azide and BSA Free (H00056917-B01P) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MEIS3 (NP_064545.1, 1 a.a. - 421 a.a.) full-length human protein. MARRYDELPHYPGIVDGPAALASFPETVPAVPGPYGPHRPPQPLPPGLDSDGLKREKDEIYGHPLFPLLALVFEKCELATCSPRDGAGAGLGTPPGGDVCSSDSFNEDIAAFAKQVRSERPLFSSNPELDNLMIQAIQVLRFHLLELEKVHDLCDNFCHRYITCLKGKMPIDLVIEDRDGGCREDFEDYPASCPSLPDQNNMWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGDGLDTSVASPSSGGEDEDLDQERRRNKKRGIFPKVATNIMRAWLFQHLSRRSEAPVLPDVCLGLGSPSPGPRWARPWGSDCGRPGRQSDSCWWLQHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETQPHVAVRPPGSVGMSLNLEGEWHYL
• Specificity: MEIS3 - Meis homeobox 3,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MEIS3
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Meis homeobox 3 Antibody - Azide and BSA Free

• DKFZp547H236
• Meis homeobox 3
• Meis1, myeloid ecotropic viral integration site 1 homolog 3 (mouse)
• Meis1, myeloid ecotropic viral integration site 1 homolog 3
• Meis1-related protein 2
• MRG2homeobox protein Meis3

Background

MEIS3, also known as Homeobox protein Meis3, has 3 isoforms, a 375 amino acid isoform that is 41 kDa, a 421 amino acid isoform that is 46 kDa, and a 358 amino acid isoform that is 39 kDa, and is nucleus located. Little is currently known about its function. Studies are performed on the relationship of this protein to neuronitis. MEIS3 protein involvement has been observed with relation to HOXA13 in the regulation of transcription, DNA-dependent, negative regulation of apoptotic process, and positive regulation of protein kinase B signaling cascade pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MEIS3
• Entrez:
  • 56917(Human)
• Uniprot:
  • NP_064545.1(Human)