Recombinant Human MEI1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MEI1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 238 of Human MEI1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MEI1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MEI1 Protein

  • meiosis defective 1
  • Meiosis defective protein 1
  • meiosis inhibitor 1
  • meiosis inhibitor protein 1
  • MGC40042

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58172
Species: Hu
Applications: WB
NB100-181
Species: Hu, Mu
Applications: WB, IP
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NBP2-02667
Species: Hu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-56552
Species: Hu
Applications: WB
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-89966
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-57487
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90335
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
AF5510
Species: Hu
Applications: WB
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP1-84254
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-217
Species: Hu, Mu
Applications: WB, IP, PLA
NBP1-89929
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010472-D01P
Species: Hu
Applications: WB, ELISA

Publications for MEI1 Recombinant Protein (H00150365-P01) (0)

There are no publications for MEI1 Recombinant Protein (H00150365-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEI1 Recombinant Protein (H00150365-P01) (0)

There are no reviews for MEI1 Recombinant Protein (H00150365-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MEI1 Recombinant Protein (H00150365-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEI1 Products

Bioinformatics Tool for MEI1 Recombinant Protein (H00150365-P01)

Discover related pathways, diseases and genes to MEI1 Recombinant Protein (H00150365-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MEI1 Recombinant Protein (H00150365-P01)

Discover more about diseases related to MEI1 Recombinant Protein (H00150365-P01).
 

Pathways for MEI1 Recombinant Protein (H00150365-P01)

View related products by pathway.

PTMs for MEI1 Recombinant Protein (H00150365-P01)

Learn more about PTMs related to MEI1 Recombinant Protein (H00150365-P01).

Blogs on MEI1

There are no specific blogs for MEI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
MEI1 Antibody
NBP2-14229

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MEI1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MEI1