We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MEGF8 Recombinant Protein Antigen

Images

 
There are currently no images for MEGF8 Protein (NBP2-14228PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MEGF8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MEGF8.

Source: E. coli

Amino Acid Sequence: PCSPMPRSPEECRRLRTCSECLARHPRTLQPGDGEASTPRCKWCTNCPEGACIGRNGSCTSENDCRINQREVFWAGNCSEAACGAADCEQCTREGKCMWTRQFKRTGETRRILSVQPTYDWTCFSHSLLNVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MEGF8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-14228.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MEGF8 Recombinant Protein Antigen

  • C19orf49
  • chromosome 19 open reading frame 49
  • EGFL4MGC120684
  • EGF-like domain-containing protein 4
  • EGF-like protein 4
  • EGF-like-domain, multiple 4
  • Epidermal growth factor-like protein 4
  • FLJ22365
  • HBV pre-s2 binding protein 1
  • KIAA0817
  • MGC138147
  • multiple EGF-like domain protein 4
  • Multiple EGF-like domains protein 8
  • multiple EGF-like-domains 8
  • multiple epidermal growth factor-like domains 8
  • multiple epidermal growth factor-like domains protein 8
  • SBP1

Background

Chimera RNA interference (chimera RNAi) is process by which small interfering RNA/DNA chimera triggers the destruction of mRNA for the original gene. The discovery work, design, and application of chimera RNAi has been pioneered by Professor Kaoru Saigo and Dr. Kumiko Ui-Tei at the University of Tokyo. Chimera RNAi has many advantages over the conventional siRNAs. First, it has been demonstrated to have reliable knock-down for over 10,000 human genes. Because the human genome is composed of an intricate, genetic network, chimera RNAi's unique design has successfully obviated the off-target effects including microRNA-based influence. Another advantage of the chimera RNAi technology is its effectiveness at low concentrations (0.5nM to 5nM); only mRNA is destroyed so genomic genes are not affected. Finally, having both the sense and anti-sense strands consisting RNA/DNA chimera, it offers much greater compound stability for streamlining in vitro and in vivo assays and applications while minimizing interferon induction and other adverse reactions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45979
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-38323
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP3-07016
Species: Hu
Applications: ELISA, S-ELISA
NB100-1443
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
AF3798
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
NBP1-86745
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB200-541
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
NB100-565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
NB100-368
Species: Hu, Mu
Applications: WB
NBP1-91781
Species: Hu
Applications: IHC,  IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-47754
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-93337
Species: Hu, Mu
Applications: IP, WB
NBP3-27784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-96874
Species: Ca, Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-89816
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-79709
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NBP1-88262
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-14228PEP
Species: Hu
Applications: AC

Publications for MEGF8 Protein (NBP2-14228PEP) (0)

There are no publications for MEGF8 Protein (NBP2-14228PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEGF8 Protein (NBP2-14228PEP) (0)

There are no reviews for MEGF8 Protein (NBP2-14228PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MEGF8 Protein (NBP2-14228PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEGF8 Products

Array NBP2-14228PEP

Blogs on MEGF8

There are no specific blogs for MEGF8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MEGF8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MEGF8