MEF2A Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

MEF2A Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MEF2A.

  Source: E. coli

  Amino Acid Sequence: DLSALQGFNSPGMLSLGQVSAWQQHHLGQAALSSLVAGGQLSQGSNLSINTNQNISIKSEP

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MEF2A
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58539.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MEF2A Recombinant Protein Antigen

• ADCAD1
• MADS box transcription enhancer factor 2, polypeptide A (myocyte enhancerfactor 2A)
• MEF2
• myocyte enhancer factor 2A
• myocyte-specific enhancer factor 2A
• RSRFC4
• RSRFC9
• Serum response factor-like protein 1

Background

MEF2A (myocyte specific enhancer factor 2) is a transcription factor protein that belongs to MEF2 family, a family of DNA binding regulatory proteins. MEF2 family members (MEF2A, 2B, 2C, and 2D) are highly expressed during dendritic maturation and synapse formation in the brain and are involved in the regulation of development and function of T-cell, muscle cells, and brain cells (1). Highly expressed during synaptogenesis, MEF2A binds to MEF2 element present in the regulatory regions in various muscle specific genes and activates transcription. MEF2A has been implicated in cardiac and skeletal muscle development (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MEF2A