MED6 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to MED6. Source: E. coli
Amino Acid Sequence: NSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MED6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55253. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
35 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MED6 Recombinant Protein Antigen
Background
MED6 also known as Mediator of RNA polymerase II transcription subunit 6, is a 246 amino acid protein that is 28 kDa; as a component of the Mediator complex, a co-activator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes, functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery, by direct interactions with regulatory proteins the mediator is recruited to promoters and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Disease research is currently being performed with relation to MED6 and spondylolysis, renal carcinoma, carcinoma, renal cell carcinoma, cholesterol, and neuronitis. This protein has also been shown to have interactions with over 70 proteins including SMAD2, SMAD1, CDK8, MED15, and MED25 in developmental biology, transcriptional regulation of white adipocyte differentiation, generic transcription pathway, gene expression, and transcription ligand-dependent transcription of retinoid-target genes pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: Flow, ICC/IF, PA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Publications for MED6 Recombinant Protein Antigen (NBP2-55253PEP) (0)
There are no publications for MED6 Recombinant Protein Antigen (NBP2-55253PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MED6 Recombinant Protein Antigen (NBP2-55253PEP) (0)
There are no reviews for MED6 Recombinant Protein Antigen (NBP2-55253PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MED6 Recombinant Protein Antigen (NBP2-55253PEP) (0)
Additional MED6 Products
Blogs on MED6