MED6 Recombinant Protein Antigen

Images

 
There are currently no images for MED6 Recombinant Protein Antigen (NBP2-55253PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED6 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to MED6.

Source: E. coli

Amino Acid Sequence: NSGSVLDYFSERSNPFYDRTCNNEVVKMQRLTLEHLNQMVGIEYILLHAQEPILFIIRKQQRQSPAQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVRPKAKRKEEPSSI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED6
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55253.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED6 Recombinant Protein Antigen

  • Activator-recruited cofactor 33 kDa component
  • ARC33
  • mediator complex subunit 6hMed6
  • mediator of RNA polymerase II transcription subunit 6
  • mediator of RNA polymerase II transcription, subunit 6 homolog (S. cerevisiae)
  • mediator of RNA polymerase II transcription, subunit 6 homolog
  • NY-REN-28
  • Renal carcinoma antigen NY-REN-28

Background

MED6 also known as Mediator of RNA polymerase II transcription subunit 6, is a 246 amino acid protein that is 28 kDa; as a component of the Mediator complex, a co-activator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes, functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery, by direct interactions with regulatory proteins the mediator is recruited to promoters and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Disease research is currently being performed with relation to MED6 and spondylolysis, renal carcinoma, carcinoma, renal cell carcinoma, cholesterol, and neuronitis. This protein has also been shown to have interactions with over 70 proteins including SMAD2, SMAD1, CDK8, MED15, and MED25 in developmental biology, transcriptional regulation of white adipocyte differentiation, generic transcription pathway, gene expression, and transcription ligand-dependent transcription of retinoid-target genes pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-13814
Species: Hu
Applications: ELISA, Flow, ICC/IF, IP, PA, WB
NBP3-05055
Species: Hu, Mu, Rt
Applications: WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
NBP3-46159
Species: Hu, Mu, Rt
Applications: ELISA, IHC
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NBP3-07348
Species: Hu
Applications: Flow, ICC/IF, PA
NBP2-87539
Species: Hu
Applications: IHC,  IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
H00001024-M03
Species: Hu, Mu, Rt
Applications: ELISA, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
NBP1-89014
Species: Hu
Applications: ChIP-EXO-SEQ, ICC/IF, IHC,  IHC-P, WB
H00009440-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB
H00009443-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB600-507
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, PEP-ELISA, WB
NBP1-85104
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
DCDL40
Species: Hu
Applications: ELISA

Publications for MED6 Recombinant Protein Antigen (NBP2-55253PEP) (0)

There are no publications for MED6 Recombinant Protein Antigen (NBP2-55253PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED6 Recombinant Protein Antigen (NBP2-55253PEP) (0)

There are no reviews for MED6 Recombinant Protein Antigen (NBP2-55253PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED6 Recombinant Protein Antigen (NBP2-55253PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED6 Products

Blogs on MED6

There are no specific blogs for MED6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED6 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED6