MED26 Antibody (2G10) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse MED26 Antibody (2G10) - Azide and BSA Free (H00009441-M06) is a monoclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CRSP7 (NP_004822, 501 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GAQTPGAHHFMSEYLKQEESTRQGARQLHVLVPQSPPTDLPGLTREVTQDDLDRIQASQWPGVNGCQDTQGNWYDWTQCISLDPHGDDGRLNILPYVCLD |
| Specificity |
CRSP7 - cofactor required for Sp1 transcriptional activation, subunit 7, 70kDa (2G10) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
MED26 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MED26 Antibody (2G10) - Azide and BSA Free
Background
The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: IP, WB (-)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, ELISA, IHC
Publications for MED26 Antibody (H00009441-M06) (0)
There are no publications for MED26 Antibody (H00009441-M06).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MED26 Antibody (H00009441-M06) (0)
There are no reviews for MED26 Antibody (H00009441-M06).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MED26 Antibody (H00009441-M06) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MED26 Products
Blogs on MED26