MED23 Recombinant Protein Antigen

Images

 
There are currently no images for MED23 Recombinant Protein Antigen (NBP2-56372PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED23 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED23.

Source: E. coli

Amino Acid Sequence: PATLRFPLKGLLPYDKDLFEPQTALLRYVLEQPYSRDMVCNMLGLNKQHKQRCPVLEDQLVDLVVYAMERSETEEKFDDG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56372.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED23 Recombinant Protein Antigen

  • 130 kDa transcriptional co-activator
  • 133 kDa transcriptional co-activator
  • CRSP130
  • DRIP130DKFZp434H0117
  • mediator complex subunit 23CRSP133
  • Protein sur-2 homolog
  • subunit 3, 130kDa
  • Transcriptional coactivator CRSP130
  • Vitamin D3 receptor-interacting protein complex 130 kDa component

Background

DRIPs are a distinct set of ligand-dependent proteins that interact with the vitamin D receptor (VDR). Together, these proteins constitute a new cofactor complex. DRIPs bind to several nuclear receptors to mediate ligand-dependent enhancement of transcription by VDR and the thyroid hormone receptor in cell-free transcription assays. The DRIPs are almost indistinguishable from components of another cofactor complex called ARC, which is recruited by other types of transcription activators to mediate transactivation on chromatin-assembled templates. The role of nuclear-receptor ligands may, in part, be to recruit such a cofactor complex to the receptor and, in doing so, to enhance transcription of target genes. In humans, interaction with Sur-2 is required for transcription to be activated by the activation domain of a transcription factor of the ETS-family in response to activated mitogen-activated protein (MAP) kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59320
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59324
Species: Ma, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP2-22403
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NBP1-30873
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC,  IHC-P, WB
NBP2-92972
Species: Hu, Mu, Rt
Applications: IP, KO, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP3-17510
Species: Hu
Applications: IHC,  IHC-P
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-38278
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-56372PEP
Species: Hu
Applications: AC

Publications for MED23 Recombinant Protein Antigen (NBP2-56372PEP) (0)

There are no publications for MED23 Recombinant Protein Antigen (NBP2-56372PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED23 Recombinant Protein Antigen (NBP2-56372PEP) (0)

There are no reviews for MED23 Recombinant Protein Antigen (NBP2-56372PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED23 Recombinant Protein Antigen (NBP2-56372PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED23 Products

Array NBP2-56372PEP

Research Areas for MED23 Recombinant Protein Antigen (NBP2-56372PEP)

Find related products by research area.

Blogs on MED23

There are no specific blogs for MED23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED23 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED23