MED15 Antibody

Images

 
Western Blot: MED15 Antibody [NBP1-89018] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32, 26, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431
Immunocytochemistry/ Immunofluorescence: MED15 Antibody [NBP1-89018] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MED15 Antibody [NBP1-89018] - Staining of human placenta shows strong nuclear and cytoplasmic positivity in trophoblastic cells.
Western Blot: MED15 Antibody [NBP1-89018] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells). Lane 3: PC12 cell lysate (Pheochromocytoma of rat ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MED15 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MED15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MED15 Protein (NBP1-89018PEP)
Publications
Read Publication using NBP1-89018.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MED15 Antibody

  • ARC105Arc105
  • CAG7A
  • CTG repeat protein 7a
  • CTG7A
  • FLJ42282
  • FLJ42935
  • mediator complex subunit 15PC2 glutamine/Q-rich-associated protein
  • mediator of RNA polymerase II transcription subunit 15
  • PC2 (positive cofactor 2, multiprotein complex) glutamine/Q-rich-associatedprotein
  • PC2-glutamine-rich-associated protein
  • PCQAPDKFZp686A2214
  • Positive cofactor 2 glutamine/Q-rich-associated protein
  • positive cofactor 2, glutamine/Q-rich-associated protein
  • TIG1DKFZp762B1216
  • TIG-1TPA-inducible gene 1 protein
  • TNRC7
  • TPA inducible gene-1
  • TPA inducible protein
  • trinucleotide repeat containing 7,105-kD
  • Trinucleotide repeat-containing gene 7 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46076
Species: Hu
Applications: WB, IHC
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF636
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-56929
Species: Hu
Applications: WB, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
NBP1-26616
Species: Hu
Applications: WB, IP
NBL1-15556
Species: Hu
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-24530
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P, Flow-IC
NBP1-89018
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MED15 Antibody (NBP1-89018)(1)

Reviews for MED15 Antibody (NBP1-89018) (0)

There are no reviews for MED15 Antibody (NBP1-89018). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MED15 Antibody (NBP1-89018) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MED15 Products

Bioinformatics Tool for MED15 Antibody (NBP1-89018)

Discover related pathways, diseases and genes to MED15 Antibody (NBP1-89018). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MED15 Antibody (NBP1-89018)

Discover more about diseases related to MED15 Antibody (NBP1-89018).
 

Pathways for MED15 Antibody (NBP1-89018)

View related products by pathway.

PTMs for MED15 Antibody (NBP1-89018)

Learn more about PTMs related to MED15 Antibody (NBP1-89018).

Blogs on MED15.

TAZ Antibody: The Devil is in the Details
WW domain-containing transcription regulator protein 1 also known as WWTR1 and TAZ, is a 44KDa protein that acts as a downstream regulatory target in the Hippo signaling pathway. This protein undergoes post-translational modification and becomes phosp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MED15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MED15