MED12 Recombinant Protein Antigen

Images

 
There are currently no images for MED12 Protein (NBP1-86670PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MED12 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MED12.

Source: E. coli

Amino Acid Sequence: RLLLYHTHLRPRPRAYYLEPLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MED12
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86670.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MED12 Recombinant Protein Antigen

  • ARC240
  • CAG repeat protein 45
  • CAGH45trinucleotide repeat containing 11 (THR-associated protein, 230kDa subunit)
  • HOPAFGS1
  • KIAA0192FG syndrome 1
  • mediator complex subunit 12OPA-containing protein
  • OKSsubunit 12 homolog
  • thyroid hormone receptor-associated protein, 230 kDa subunit
  • Trap230
  • TRAP230mediator of RNA polymerase II transcription, subunit 12 homolog (S. cerevisiae)
  • trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subunit)
  • Trinucleotide repeat-containing gene 11 protein

Background

The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-55288
Species: Fi, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
H00009927-M03
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, RNAi, WB
H00055669-M04
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IP, KD, WB
NBP3-47447
Species: Hu, Rt
Applications: ELISA, IHC, WB
NBP2-16148
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-02477
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-76651
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-85664
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-60642
Species: Hu, Pm
Applications: IP, WB
NBP2-92972
Species: Hu, Mu, Rt
Applications: IP, KO, WB
NBP2-92902
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-92221
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC,  IHC-P, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NBP1-80878
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-86670PEP
Species: Hu
Applications: AC

Publications for MED12 Protein (NBP1-86670PEP) (0)

There are no publications for MED12 Protein (NBP1-86670PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MED12 Protein (NBP1-86670PEP) (0)

There are no reviews for MED12 Protein (NBP1-86670PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MED12 Protein (NBP1-86670PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MED12 Products

Array NBP1-86670PEP

Research Areas for MED12 Protein (NBP1-86670PEP)

Find related products by research area.

Blogs on MED12

There are no specific blogs for MED12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MED12 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MED12