MED12 Antibody

Western Blot: MED12 Antibody [H00009968-A01] - Western Blot detection against Immunogen (38.54 KDa) .

Product Discontinued

MED12 Antibody Summary

• Immunogen: MED12 (NP_005111, 1829 a.a. - 1941 a.a.) partial recombinant protein with GST tag. QPATKTEDYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRPVRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVP
• Specificity: MED12 - mediator of RNA polymerase II transcription, subunit 12 homolog (yeast)
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MED12
• Purity: Unpurified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: The quality control of this antibody is limited to Western blot on the immunizing protein. It has also been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: 50 % glycerol
• Preservative: No Preservative
• Purity: Unpurified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MED12 Antibody

• ARC240
• CAG repeat protein 45
• CAGH45trinucleotide repeat containing 11 (THR-associated protein, 230kDa subunit)
• HOPAFGS1
• KIAA0192FG syndrome 1
• mediator complex subunit 12OPA-containing protein
• OKSsubunit 12 homolog
• thyroid hormone receptor-associated protein, 230 kDa subunit
• Trap230
• TRAP230mediator of RNA polymerase II transcription, subunit 12 homolog (S. cerevisiae)
• trinucleotide repeat containing 11 (THR-associated protein, 230 kDa subunit)
• Trinucleotide repeat-containing gene 11 protein

Background

The initiation of transcription is controlled in part by a large protein assembly known as the preinitiation complex. A component of this preinitiation complex is a 1.2 MDa protein aggregate called Mediator. This Mediator component binds with a CDK8 subcomplex which contains the protein encoded by this gene, mediator complex subunit 12 (MED12), along with MED13, CDK8 kinase, and cyclin C. The CDK8 subcomplex modulates Mediator-polymerase II interactions and thereby regulates transcription initiation and reinitation rates. The MED12 protein is essential for activating CDK8 kinase. Defects in this gene cause X-linked Opitz-Kaveggia syndrome, also known as FG syndrome, and Lujan-Fryns syndrome. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MED12 Antibody (H00009968-A01)(3)

Publications using H00009968-A01

• Nakayama K, Szewczyk MM, Dela Sena C et al. TP-064, a potent and selective small molecule inhibitor of PRMT4 for multiple myeloma. Oncotarget. 2018-04-06 [PMID: 29719619]
• Shen Y, Szewczyk MM, Eram MS et al. Discovery of a Potent, Selective and Cell-active Dual Inhibitor of Protein Arginine Methyltransferase 4 and Protein Arginine Methyltransferase 6. J Med Chem 2016-09-01 [PMID: 27584694]
• Rienzo M, Casamassimi A, Schiano C et al. Distinct alternative splicing patterns of mediator subunit genes during endothelial progenitor cell differentiation. Biochimie. 2012-04-09 [PMID: 22531626]

Bioinformatics

• Gene Symbol: MED12
• Entrez:
  • 9968(Human)
• OMIM:
  • 300188(Human)
• Uniprot:
  • NP_005111(Human)