MDR3/ABCB4 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related MDR3/ABCB4 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-30887PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MDR3/ABCB4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ABCB4.

Source: E. coli

Amino Acid Sequence: HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ABCB4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-30887.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MDR3/ABCB4 Recombinant Protein Antigen

  • ABC21
  • ABCB4
  • ATP-binding cassette sub-family B member 4
  • ATP-binding cassette, sub-family B (MDR/TAP), member 4
  • EC 3.6.3
  • EC 3.6.3.44
  • GBD1
  • MDR2
  • MDR3
  • MDR3MDR2/3
  • multidrug resistance protein 3
  • multiple drug resistance 3
  • P glycoprotein 3/multiple drug resistance 3
  • PFIC-3
  • P-glycoprotein 3
  • P-glycoprotein-3/multiple drug resistance-3
  • PGY3
  • PGY3GBD1

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-89319
Species: Hu
Applications: IHC,  IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-69023
Species: Mu
Applications: WB
NB400-156
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-90068
Species: Hu
Applications: IHC,  IHC-P
NBP1-76670
Species: Hu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-22124
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-41339
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF6278
Species: Hu, Mu
Applications: WB
PP-A9033A-00
Species: Hu
Applications: DirELISA, IHC, IP, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-556
Species: Hu
Applications: IP, WB
NBP1-60109
Species: Hu
Applications: B/N, Flow, WB
NBP2-23488
Species: Hu
Applications: ELISA, Flow, ICC/IF (-), IHC,  IHC-P, WB

Publications for MDR3/ABCB4 Protein (NBP2-30887PEP) (0)

There are no publications for MDR3/ABCB4 Protein (NBP2-30887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MDR3/ABCB4 Protein (NBP2-30887PEP) (0)

There are no reviews for MDR3/ABCB4 Protein (NBP2-30887PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MDR3/ABCB4 Protein (NBP2-30887PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MDR3/ABCB4 Products

Research Areas for MDR3/ABCB4 Protein (NBP2-30887PEP)

Find related products by research area.

Blogs on MDR3/ABCB4

There are no specific blogs for MDR3/ABCB4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MDR3/ABCB4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCB4