MDR3/ABCB4 Antibody

Immunocytochemistry/Immunofluorescence: MDR3/ABCB4 Antibody [NBP2-30887] - Staining of human cell line U-2 OS shows localization to nucleoplasm, plasma membrane & focal adhesion sites. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MDR3/ABCB4 Antibody [NBP2-30887] - Staining of human liver shows strong positivity in bile canaliculi.

Product Discontinued

MDR3/ABCB4 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCB4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MDR3/ABCB4 Antibody

• ABC21
• ABCB4
• ATP-binding cassette sub-family B member 4
• ATP-binding cassette, sub-family B (MDR/TAP), member 4
• EC 3.6.3
• EC 3.6.3.44
• GBD1
• MDR2
• MDR3
• MDR3MDR2/3
• multidrug resistance protein 3
• multiple drug resistance 3
• P glycoprotein 3/multiple drug resistance 3
• PFIC-3
• P-glycoprotein 3
• P-glycoprotein-3/multiple drug resistance-3
• PGY3
• PGY3GBD1

Background

The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MDR3/ABCB4 Antibody (NBP2-30887)(1)

Publication using NBP2-30887

• Sticova E, Neroldova M, Kotalova R et al. ABCB4 disease mimicking morbus Wilson: A potential diagnostic pitfall Biomed Pap Med Fac Univ Palacky Olomouc Czech Repub 2019-11-15 [PMID: 31728073] (Human)

Bioinformatics

• Gene Symbol: ABCB4
• Uniprot:
  • P21439(Human)