MDR3/ABCB4 Antibody

Product Discontinued

MDR3/ABCB4 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ABCB4(ATP-binding cassette, sub-family B (MDR/TAP), member 4) The peptide sequence was selected from the N terminal of ABCB4 (NP_000434). Peptide sequence AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM. The peptide sequence for this immunogen was taken from within the described region.
• Predicted Species: Mouse (100%), Rat (100%), Porcine (93%), Rabbit (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABCB4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.2-1 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ABCB4 and was validated on Western blot.
• Theoretical MW: 141 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS & 2% Sucrose.
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MDR3/ABCB4 Antibody

• ABC21
• ABCB4
• ATP-binding cassette sub-family B member 4
• ATP-binding cassette, sub-family B (MDR/TAP), member 4
• EC 3.6.3
• EC 3.6.3.44
• GBD1
• MDR2
• MDR3
• MDR3MDR2/3
• multidrug resistance protein 3
• multiple drug resistance 3
• P glycoprotein 3/multiple drug resistance 3
• PFIC-3
• P-glycoprotein 3
• P-glycoprotein-3/multiple drug resistance-3
• PGY3
• PGY3GBD1

Background

ABCB4, a membrane-associated protein, is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. ABCB4 is a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile.The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a full transporter and member of the p-glycoprotein family of membrane proteins with phosphatidylcholine as its substrate. The function of this protein has not yet been determined; however, it may involve transport of phospholipids from liver hepatocytes into bile. Alternative splicing of this gene results in several products of undetermined function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABCB4
• Entrez:
  • 5244(Human)
• Uniprot:
  • P21439(Human)