MCM8 Antibody (1F9) - Azide and BSA Free

Sandwich ELISA: MCM8 Antibody (1F9) [H00084515-M02] - Detection limit for recombinant GST tagged MCM8 is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MCM8 Antibody (1F9) - Azide and BSA Free Summary

• Immunogen: MCM8 (AAH08830, 646 a.a. ~ 735 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TYSDEFGNLDFERSQHGSGMSNRSTAKRFISALNNVAERTYNNIFQFHQLRQIAKELNIQVADFENFIGSLNDQGYLLKKGPKVYQLQTM
• Specificity: MCM8 - MCM8 minichromosome maintenance deficient 8 (S. cerevisiae)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MCM8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCM8 Antibody (1F9) - Azide and BSA Free

• C20orf154
• chromosome 20 open reading frame 154
• dJ967N21.5
• DNA replication licensing factor MCM8
• MCM8 minichromosome maintenance deficient 8
• MGC119522
• MGC119523
• MGC12866
• MGC4816
• Minichromosome maintenance 8
• minichromosome maintenance complex component 8
• REC homolog
• REC

Background

The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein contains the central domain that is conserved among the MCM proteins. This protein has been shown to co-immunoprecipitate with MCM4, 6 and 7, which suggests that it may interact with other MCM proteins and play a role in DNA replication. Alternatively spliced transcript variants encoding distinct isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MCM8 Antibody (H00084515-M02)(1)

Publication using H00084515-M02

• Klucnika A, Mu P, Jezek J et al. REC drives recombination to repair double-strand breaks in animal mtDNA The Journal of cell biology 2023-01-02 [PMID: 36355348] (WB, Human)

Bioinformatics

• Gene Symbol: MCM8
• Entrez:
  • 84515(Human)
• OMIM:
  • 608187(Human)
• Uniprot:
  • AAH08830(Human)