MCAT Antibody (2F2)

Images

 
Western Blot: MCAT Antibody (2F2) [H00027349-M01] - MT monoclonal antibody (M01), clone 2F2 Analysis of MT expression in HeLa.
Immunohistochemistry-Paraffin: MCAT Antibody (2F2) [H00027349-M01] - Analysis of monoclonal antibody to MT on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: MCAT Antibody (2F2) [H00027349-M01] - Detection limit for recombinant GST tagged MT is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
2F2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MCAT Antibody (2F2) Summary

Immunogen
MT (NP_775738, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKPLVSVYSNVHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKSCNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
Localization
Mitochondrial
Specificity
MT - malonyl-CoA:acyl carrier protein transacylase, mitochondrial
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MCAT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MCAT Antibody (2F2)

  • EC 2.3.1.39
  • fabD
  • FASN2C
  • malonyl CoA:ACP acyltransferase (mitochondrial)
  • malonyl-CoA:acyl carrier protein transacylase, mitochondrial
  • malonyl-CoA-acyl carrier protein transacylase, mitochondrial
  • MCT[Acyl-carrier-protein] malonyltransferase
  • Mitochondrial malonyltransferase
  • MTMGC47838
  • NET62

Background

The protein encoded by this gene is found exclusively in the mitochondrion, where it catalyzes the transfer of a malonyl group from malonyl-CoA to the mitochondrial acyl carrier protein. The encoded protein may be part of a fatty acid synthase complex that is more like the type II prokaryotic and plastid complexes rather than the type I human cytosolic complex. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MCAT Antibody (H00027349-M01) (0)

There are no publications for MCAT Antibody (H00027349-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MCAT Antibody (H00027349-M01) (0)

There are no reviews for MCAT Antibody (H00027349-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MCAT Antibody (H00027349-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MCAT Antibody (2F2) and receive a gift card or discount.

Bioinformatics

Gene Symbol MCAT
Entrez
Uniprot