Recombinant Human MBD3L1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MBD3L1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 194 of Human MBD3L1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAKSSQRKQRDCVNQCKSKPGLSTSIPLRMSSYTFKRPVTRITPHPGNEVRYHQWEESLEKPQQVCWQRRLQGLQAYSSAGELSSTLDLANTLQKLVPSYTGGSLLEDLASGLEHSCPMPHLACSSDAVEIIPAEGVGISQLLCKQFLVTEEDIRKQEGKVKTVRERLAIALIADGLANEAEKVRDQEGCPEKR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
MBD3L1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MBD3L1 Protein

  • MBD3L
  • MBD3-like protein 1
  • methyl-CpG binding domain protein 3-like 1
  • methyl-CpG binding domain protein 3-like
  • methyl-CpG-binding domain protein 3-like 1
  • MGC138263
  • MGC138269

Background

This gene encodes a protein that is related to methyl-CpG-binding proteins but lacks the methyl-CpG binding domain. The protein is localized to discrete areas in the nucleus, and expression appears to be restricted to round spermatids, suggesting that the protein plays a role in the postmeiotic stages of male germ cell development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-81657
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-86304
Species: Hu
Applications: IHC, IHC-P
NB100-56534
Species: Hu
Applications: WB, IHC-P, ICC
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NBP1-87109
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NBP1-86087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89481
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
H00089884-M15
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00006047-A01
Species: Hu
Applications: WB, ELISA
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MBD3L1 Recombinant Protein (H00085509-P01) (0)

There are no publications for MBD3L1 Recombinant Protein (H00085509-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MBD3L1 Recombinant Protein (H00085509-P01) (0)

There are no reviews for MBD3L1 Recombinant Protein (H00085509-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MBD3L1 Recombinant Protein (H00085509-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MBD3L1 Products

Bioinformatics Tool for MBD3L1 Recombinant Protein (H00085509-P01)

Discover related pathways, diseases and genes to MBD3L1 Recombinant Protein (H00085509-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MBD3L1 Recombinant Protein (H00085509-P01)

Discover more about diseases related to MBD3L1 Recombinant Protein (H00085509-P01).
 

Pathways for MBD3L1 Recombinant Protein (H00085509-P01)

View related products by pathway.

PTMs for MBD3L1 Recombinant Protein (H00085509-P01)

Learn more about PTMs related to MBD3L1 Recombinant Protein (H00085509-P01).

Blogs on MBD3L1

There are no specific blogs for MBD3L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

HDAC1 Antibody
NB100-56340
MBD3L1 Antibody
NBP2-30978

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MBD3L1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MBD3L1