Maxi Potassium channel beta Antibody - BSA Free

Western Blot: Maxi Potassium channel beta Antibody [NBP3-03655] - Analysis of extracts of various cell lines, using Maxi Potassium channel beta antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST

Product Discontinued

Maxi Potassium channel beta Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human Maxi Potassium channel beta (NP_004128.1). TYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNMB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:200-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Maxi Potassium channel beta Antibody - BSA Free

• BK channel beta subunit
• BK channel subunit beta-1
• BKbeta
• BKbeta1
• Calcium-activated potassium channel subunit beta
• calcium-activated potassium channel subunit beta-1
• Calcium-activated potassium channel, subfamily M subunit beta-1
• Charybdotoxin receptor subunit beta-1
• Hbeta1
• hslo-beta
• K(VCA)beta
• K(VCA)beta-1
• KCNMB1
• large conductance Ca2+-activated K+ channel beta 1 subunit
• Maxi K channel beta subunit
• Maxi K channel subunit beta-1
• Maxi Potassium channel beta
• potassium large conductance calcium-activated channel, subfamily M, beta member1
• Slo-beta
• Slo-beta-1

Background

Potassium channels are a group of ubiquitously expressed proteins that serve numerous functions in excitable and non-excitable cells. One class of integral membrane potassium channels is the large conductance, calcium-activated potassium channel (Maxi K+). Maxi K+ differs from most other potassium channels in that its activation is controlled by both increases in intracellular calcium and by membrane depolarization. Maxi K+ dual activation is possible because of its structure. The core of the channel, which is similar to other potassium channels, is a Maxi K+ alpha homotetramer that contains both a voltage sensor and an intracellular calcium binding domain. In vascular smooth muscle, an auxiliary beta-subunit is found in a 1:1 stoichiometry. The beta-subunit exhibits its effect on the Maxi K+ channel by effectively decreasing by 5- to 10- fold the concentration of calcium required to keep the pore open. Maxi K+ beta is the target for possible therapeutics because of its role in blood flow and blood pressure regulation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNMB1