Matrilin-4 Antibody - BSA Free

Western Blot: Matrilin-4 Antibody [NBP1-98551] - Antibody Dilution: 1.0ug/ml Sample Tissue: HepG2 cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Matrilin-4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: The immunogen for this antibody is MATN4 - N-terminal region. Peptide sequence LRGLNVGPNATRVGVIQYSSQVQSVFPLRAFSRREDMERAIRDLVPLAQG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MATN4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 53 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Matrilin-4 Antibody - BSA Free

• FLJ14417
• MATN4
• matrilin 4
• Matrilin4
• Matrilin-4

Background

This gene encodes a member of von Willebrand factor A domain containing protein family. The proteins of this family are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. The specific function of this gene product has not yet been determined. Three alternatively spliced variants have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Matrilin-4 Antibody (NBP1-98551)(1)

Publication using NBP1-98551

• Dozio SM, Montesi M, Campodoni E et al. Differences in osteogenic induction of human mesenchymal stem cells between a tailored 3D hybrid scaffold and a 2D standard culture J Mater Sci Mater Med 2019-12-04 [PMID: 31802234] (WB)

Bioinformatics

• Gene Symbol: MATN4
• Uniprot:
  • NP_085095()