We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

MATK Recombinant Protein Antigen

Images

 
There are currently no images for MATK Recombinant Protein Antigen (NBP3-17887PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MATK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MATK

Source: E. coli

Amino Acid Sequence: YSKDKGAICTKLVRPKRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MATK
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17887.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MATK Recombinant Protein Antigen

  • CHK
  • Csk-type protein tyrosine kinase
  • CTKEC 2.7.10.2
  • DKFZp434N1212
  • EC 2.7.10
  • Hematopoietic consensus tyrosine-lacking kinase
  • HHYLTK
  • hydroxyaryl-protein kinase
  • HYL tyrosine kinase
  • HYLCsk-homologous kinase
  • HYLTK
  • leukocyte carboxyl-terminal src kinase related
  • Lsk
  • megakaryocyte-associated tyrosine kinase
  • megakaryocyte-associated tyrosine-protein kinase
  • MGC1708
  • MGC2101
  • Protein kinase HYL
  • tyrosine kinase MATK
  • Tyrosine-protein kinase CTK
  • tyrosylprotein kinase

Background

MATK, or Megakaryocyte-Associated Tyrosine-Protein Kinase, contains three isoforms that are 56 kDa, 57 kDa, and 52 kDa, and is involved in the regulation of tyrosine kinase and the inhibition of T-cell proliferation. MATK may play a role in signaling in certain types of breast cancer, and the protein is currently being used in research of a variety of diseases and disorders, including macular degeneration, endocarditis, neuroblastoma, colon cancer, ataxia, pharyngitis, pancreatitis, and pancreatic cancer. MATK is linked to the Kit Receptor signaling pathway, the IL-3 signaling pathway, the Neurotrophin signaling pathway, and ERBB2 signaling, through which it interacts with ERBB2, PTK2B, EWSR1, PXN, and SRC.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-85951
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
NB100-56546
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
255-SC
Species: Hu
Applications: BA
1129-ER
Species: Hu
Applications: BA
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
NBP1-80025
Species: Hu
Applications: IHC,  IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-90816
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-86602
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB6210
Species: Hu
Applications: Simple Western, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB

Publications for MATK Recombinant Protein Antigen (NBP3-17887PEP) (0)

There are no publications for MATK Recombinant Protein Antigen (NBP3-17887PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MATK Recombinant Protein Antigen (NBP3-17887PEP) (0)

There are no reviews for MATK Recombinant Protein Antigen (NBP3-17887PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MATK Recombinant Protein Antigen (NBP3-17887PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MATK Products

Research Areas for MATK Recombinant Protein Antigen (NBP3-17887PEP)

Find related products by research area.

Blogs on MATK

There are no specific blogs for MATK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MATK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MATK