MATH2/NEUROD6 Antibody (3G7)

Images

 
Western Blot: MATH2/NEUROD6 Antibody (3G7) [H00063974-M17] - Analysis of NEUROD6 expression in transfected 293T cell line by NEUROD6 monoclonal antibody (M17), clone 3G7. Lane 1: NEUROD6 transfected lysatE (38.705 KDa). ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3G7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MATH2/NEUROD6 Antibody (3G7) Summary

Immunogen
NEUROD6 (NP_073565.2, 246 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. STSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPLGQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
Specificity
NEUROD6 - neurogenic differentiation 6 (3G7)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NEUROD6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MATH2/NEUROD6 Antibody (3G7)

  • Atoh2
  • BHLHA2
  • bHLHa2MATH2
  • Class A basic helix-loop-helix protein 2
  • Math-2
  • NeuroD6
  • neurogenic differentiation 6
  • neurogenic differentiation factor 6
  • NEX1M
  • Protein atonal homolog 2

Background

NEUROD6 is a member of the NEUROD (NEUROD1; MIM 601724) family of basic helix-loop-helix (bHLH) transcription factors (Guo et al., 2002 [PubMed 12357074]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2746
Species: Hu, Mu
Applications: ICC, WB
AF2775
Species: Hu, Mu
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00058158-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-45693
Species: Hu, Mu, Rt
Applications: IHC, WB
256-GF/CF
Species: Hu
Applications: BA
AF2567
Species: Mu
Applications: IHC, WB
MAB3314
Species: Hu, Rt
Applications: IHC
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-47871
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF4377
Species: Hu, Mu
Applications: ICC, Simple Western, WB
NBP1-87892
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP1-80886
Species: Hu
Applications: Flow, IHC, IHC-P, IP, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NBP3-13349
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
355-BM/CF
Species: Hu, Mu, Rt
Applications: BA

Publications for MATH2/NEUROD6 Antibody (H00063974-M17) (0)

There are no publications for MATH2/NEUROD6 Antibody (H00063974-M17).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MATH2/NEUROD6 Antibody (H00063974-M17) (0)

There are no reviews for MATH2/NEUROD6 Antibody (H00063974-M17). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MATH2/NEUROD6 Antibody (H00063974-M17) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MATH2/NEUROD6 Products

Bioinformatics Tool for MATH2/NEUROD6 Antibody (H00063974-M17)

Discover related pathways, diseases and genes to MATH2/NEUROD6 Antibody (H00063974-M17). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MATH2/NEUROD6 Antibody (H00063974-M17)

Discover more about diseases related to MATH2/NEUROD6 Antibody (H00063974-M17).
 

Pathways for MATH2/NEUROD6 Antibody (H00063974-M17)

View related products by pathway.

PTMs for MATH2/NEUROD6 Antibody (H00063974-M17)

Learn more about PTMs related to MATH2/NEUROD6 Antibody (H00063974-M17).

Blogs on MATH2/NEUROD6

There are no specific blogs for MATH2/NEUROD6, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MATH2/NEUROD6 Antibody (3G7) and receive a gift card or discount.

Bioinformatics

Gene Symbol NEUROD6
Entrez
Uniprot