MAST4 Partial Protein

Images

 
SDS-Page: MAST4 Partial Protein [H00375449-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, PAGE

Order Details

MAST4 Partial Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2605 - 2699 of Human MAST4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LPLESHHPDPNTMGGASHRDRALSVTATVGETKGKDPAPAQPPPARKQNVGRDVTKPSPAPNTDRPISLSNEKDFVVRQRRGKESLRSSPHKKAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Protein
Gene
MAST4
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MAST4 Partial Protein

  • KIAA0303

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15910
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17228
Species: Mu
Applications: WB
NBP1-82993
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87899
Species: Hu
Applications: IHC, IHC-P
NBP1-83680
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-82224
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82642
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF2567
Species: Mu
Applications: WB, IHC
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-38740
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MAST4 Partial Recombinant Protein (H00375449-Q01) (0)

There are no publications for MAST4 Partial Recombinant Protein (H00375449-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAST4 Partial Recombinant Protein (H00375449-Q01) (0)

There are no reviews for MAST4 Partial Recombinant Protein (H00375449-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAST4 Partial Recombinant Protein (H00375449-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAST4 Products

Bioinformatics Tool for MAST4 Partial Recombinant Protein (H00375449-Q01)

Discover related pathways, diseases and genes to MAST4 Partial Recombinant Protein (H00375449-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAST4 Partial Recombinant Protein (H00375449-Q01)

Discover more about diseases related to MAST4 Partial Recombinant Protein (H00375449-Q01).

Research Areas for MAST4 Partial Recombinant Protein (H00375449-Q01)

Find related products by research area.

Blogs on MAST4

There are no specific blogs for MAST4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAST4 Antibody
NBP1-83017
MRP1 Antibody (IU2H10)
NB400-156-0.1ml

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAST4 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAST4