MASP2 Recombinant Protein Antigen

Images

 
There are currently no images for MASP2 Protein (NBP1-81259PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MASP2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MASP2.

Source: E. coli

Amino Acid Sequence: PVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MASP2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81259.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MASP2 Recombinant Protein Antigen

  • EC 3.4.21
  • EC 3.4.21.104
  • mannan-binding lectin serine peptidase 1 pseudogene 1
  • mannan-binding lectin serine peptidase 2
  • mannan-binding lectin serine protease 1 pseudogene 1
  • mannan-binding lectin serine protease 2
  • Mannose-binding protein-associated serine protease 2
  • MAP19
  • MASP1P1
  • MASP-2
  • MBL-associated plasma protein of 19 kD
  • MBL-associated serine protease 2
  • small MBL-associated protein
  • sMAP

Background

The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components that are involved in the mannan-binding lectin pathway of complement activation. The longer isoform is cleaved into two chains which form a heterodimer linked by a disulfide bond. The encoded proteins are members of the trypsin family of peptidases. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
AF1724
Species: Hu
Applications: IP, WB
NBP2-34234
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P
NB200-540
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP
AF1936
Species: Hu
Applications: IP, WB
NBP2-36776
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
2428-FC
Species: Hu
Applications: Bind
NBP2-01625
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
2367-FC
Species: Hu
Applications: Bind
AF1807
Species: Hu
Applications: IP, WB
NBP3-12295
Species: Hu, Pm, Rt
Applications: ELISA, IHC,  IHC-P, IP, WB
NBP1-84706
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87492
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-93935
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-88527
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89530
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB

Publications for MASP2 Protein (NBP1-81259PEP) (0)

There are no publications for MASP2 Protein (NBP1-81259PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MASP2 Protein (NBP1-81259PEP) (0)

There are no reviews for MASP2 Protein (NBP1-81259PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MASP2 Protein (NBP1-81259PEP). (Showing 1 - 1 of 1 FAQ).

  1. We wish to measure MASP-2 levels in human plasma. Are stored plasma (or serum) at -20 centigrade stabile for this measurement if only frozen once. Should we measure in duplicate or triplicate? Is plasma better than serum as I have both stored for the MASP-2 test? What would be the cost of a kit and how many samples would it measure? I assume there is no special equipment other than ELISA like stuff? What is the shelf life as I have holiday next month? Is the a list of equipment we need to run the kits so I can check it with our lab technicians.
    • Once frozen samples should be fine for measurement. Generally, all experiments should be performed at least in triplicate so you can perform statistical analysis. MASP-2 should be detectable in both serum and plasma. Serum might yield cleaner signals since it is depleted of blood cells and clotting factors, but the depletion could, theoretically remove some MSAP-2 as well. Either type of sample should be suitable though. We currently have no MASP2 ELISA kits available. A list of our MASP2 antibodies can be found at this link if you would like to make your own. We guarantee all of our antibodies for 6 months from the receipt date.

Additional MASP2 Products

Blogs on MASP2

There are no specific blogs for MASP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MASP2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MASP2