Recombinant Human MARCH9 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MARCH9 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 240 - 345 of Human MARCH9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTT

Protein/Peptide Type
Partial Recombinant Protein
Gene
MARCH9

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MARCH9 Protein

  • E3 ubiquitin-protein ligase MARCH9
  • EC 6.3.2.-
  • FLJ36578
  • MARCH-IX
  • membrane-associated ring finger (C3HC4) 9
  • Membrane-associated RING finger protein 9
  • Membrane-associated RING-CH protein IX
  • RNF179RING finger protein 179

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
796-IC
Species: Mu
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB1642
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-76959
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAB1934
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP2-24502
Species: Hu, Mu, Rt, Eq, Pm
Applications: WB, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
MAB6967
Species: Hu
Applications: WB
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-91637
Species: Hu
Applications: IHC, IHC-P
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00092979-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for MARCH9 Partial Recombinant Protein (H00092979-Q01) (0)

There are no publications for MARCH9 Partial Recombinant Protein (H00092979-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH9 Partial Recombinant Protein (H00092979-Q01) (0)

There are no reviews for MARCH9 Partial Recombinant Protein (H00092979-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MARCH9 Partial Recombinant Protein (H00092979-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MARCH9 Products

Bioinformatics Tool for MARCH9 Partial Recombinant Protein (H00092979-Q01)

Discover related pathways, diseases and genes to MARCH9 Partial Recombinant Protein (H00092979-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH9 Partial Recombinant Protein (H00092979-Q01)

Discover more about diseases related to MARCH9 Partial Recombinant Protein (H00092979-Q01).
 

Pathways for MARCH9 Partial Recombinant Protein (H00092979-Q01)

View related products by pathway.

PTMs for MARCH9 Partial Recombinant Protein (H00092979-Q01)

Learn more about PTMs related to MARCH9 Partial Recombinant Protein (H00092979-Q01).
 

Research Areas for MARCH9 Partial Recombinant Protein (H00092979-Q01)

Find related products by research area.

Blogs on MARCH9

There are no specific blogs for MARCH9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MARCH9 Antibody (2B5)
H00092979-M01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MARCH9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH9