MARCH6 Antibody (2F7) - Azide and BSA Free

Sandwich ELISA: MARCH6 Antibody (2F7) [H00010299-M02] - Detection limit for recombinant GST tagged MARCH6 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2F7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MARCH6 Antibody (2F7) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MARCH6 Antibody (2F7) - Azide and BSA Free (H00010299-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MARCH6 (NP_005876, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEYCELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
• Specificity: MARCH6 (2F7)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MARCHF6
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MARCH6 Antibody (2F7) - Azide and BSA Free

• E3 ubiquitin-protein ligase MARCH6
• EC 6.3.2.-
• MARCH-VIDOA10
• membrane-associated ring finger (C3HC4) 6
• Membrane-associated RING finger protein 6
• Membrane-associated RING-CH protein VI
• Protein TEB-4
• RNF176KIAA0597Doa10 homolog
• TEB4RING finger protein 176

Background

MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCHF6
• Entrez:
  • 10299(Human)
• Uniprot:
  • NP_005876(Human)