MARCH4 Antibody - BSA Free

Western Blot: MARCH4 Antibody [NBP1-59736] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MARCH4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MARCH4(membrane-associated ring finger (C3HC4) 4) The peptide sequence was selected form the N terminal of 40241. Peptide sequence GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNTLPALGAG. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCH4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MARCH4 Antibody - BSA Free

• EC 6.3.2.-
• KIAA1399E3 ubiquitin-protein ligase MARCH4
• MARCH-IVMGC104908
• membrane-associated ring finger (C3HC4) 4
• Membrane-associated RING finger protein 4
• Membrane-associated RING-CH protein IV
• RNF174RING finger protein 174

Background

MARCH4 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I and CD4, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCH4
• OMIM:
  • NP_065865(Human)
• Uniprot:
  • Q9P2E8(Human)