MARCH4 Antibody


Western Blot: MARCH4 Antibody [NBP1-59736] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MARCH4 Antibody Summary

Synthetic peptides corresponding to MARCH4(membrane-associated ring finger (C3HC4) 4) The peptide sequence was selected form the N terminal of 40241. Peptide sequence GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNTLPALGAG.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against MARCH4 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MARCH4 Antibody

  • EC 6.3.2.-
  • KIAA1399E3 ubiquitin-protein ligase MARCH4
  • MARCH-IVMGC104908
  • membrane-associated ring finger (C3HC4) 4
  • Membrane-associated RING finger protein 4
  • Membrane-associated RING-CH protein IV
  • RNF174RING finger protein 174


MARCH4 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I and CD4, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB

Publications for MARCH4 Antibody (NBP1-59736) (0)

There are no publications for MARCH4 Antibody (NBP1-59736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH4 Antibody (NBP1-59736) (0)

There are no reviews for MARCH4 Antibody (NBP1-59736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MARCH4 Antibody (NBP1-59736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MARCH4 Antibody (NBP1-59736)

Discover related pathways, diseases and genes to MARCH4 Antibody (NBP1-59736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH4 Antibody (NBP1-59736)

Discover more about diseases related to MARCH4 Antibody (NBP1-59736).

Pathways for MARCH4 Antibody (NBP1-59736)

View related products by pathway.

Research Areas for MARCH4 Antibody (NBP1-59736)

Find related products by research area.

Blogs on MARCH4

There are no specific blogs for MARCH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MARCH4 Antibody and receive a gift card or discount.


Gene Symbol MARCH4