MARCH4 Antibody

Images

 
Western Blot: MARCH4 Antibody [NBP1-59736] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MARCH4 Antibody Summary

Immunogen
Synthetic peptides corresponding to MARCH4(membrane-associated ring finger (C3HC4) 4) The peptide sequence was selected form the N terminal of 40241. Peptide sequence GLLKCRCRMLFNDLKVFLLRRPPQAPLPMHGDPQPPGLAANNTLPALGAG.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MARCH4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This is a rabbit polyclonal antibody against MARCH4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MARCH4 Antibody

  • EC 6.3.2.-
  • KIAA1399E3 ubiquitin-protein ligase MARCH4
  • MARCH-IVMGC104908
  • membrane-associated ring finger (C3HC4) 4
  • Membrane-associated RING finger protein 4
  • Membrane-associated RING-CH protein IV
  • RNF174RING finger protein 174

Background

MARCH4 is an E3 ubiquitin-protein ligase that may mediate ubiquitination of MHC-I and CD4, and promote their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00092979-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89357
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP
NBP1-82847
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49496
Species: Hu
Applications: IHC, IHC-P
NBP1-46179
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
9090-B2
Species: Hu
NBP1-92179
Species: Hu
Applications: IHC, IHC-P
NBP1-85540
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56761
Species: Hu
Applications: WB
NBP1-59736
Species: Hu
Applications: WB

Publications for MARCH4 Antibody (NBP1-59736) (0)

There are no publications for MARCH4 Antibody (NBP1-59736).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH4 Antibody (NBP1-59736) (0)

There are no reviews for MARCH4 Antibody (NBP1-59736). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MARCH4 Antibody (NBP1-59736) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MARCH4 Antibody (NBP1-59736)

Discover related pathways, diseases and genes to MARCH4 Antibody (NBP1-59736). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MARCH4 Antibody (NBP1-59736)

Discover more about diseases related to MARCH4 Antibody (NBP1-59736).
 

Pathways for MARCH4 Antibody (NBP1-59736)

View related products by pathway.

Research Areas for MARCH4 Antibody (NBP1-59736)

Find related products by research area.

Blogs on MARCH4

There are no specific blogs for MARCH4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MARCH4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MARCH4
OMIM
Uniprot