MARCH2 Antibody

Western Blot: MARCH2 Antibody [NBP1-91638] - Analysis in control (vector only transfected HEK293T lysate) and LY413937 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: MARCH2 Antibody [NBP1-91638] - Staining of human skin shows strong cytoplasmic and granular cytoplasmic positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: MARCH2 Antibody [NBP1-91638] - Staining of human cerebral cortex shows strong cytoplasmic and granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: MARCH2 Antibody [NBP1-91638] - Staining of human skeletal muscle shows strong cytoplasmic and granular cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: MARCH2 Antibody [NBP1-91638] - Staining of human colon shows strong cytoplasmic and granular cytoplasmic positivity in glandular cells.

Product Discontinued

MARCH2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPLAAGLLKKVAEETPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MARCH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MARCH2 Antibody

• EC 6.3.2
• EC 6.3.2.-
• MARCH-IIHSPC240
• membrane-associated ring finger (C3HC4) 2
• Membrane-associated RING finger protein 2
• Membrane-associated RING-CH protein II
• RING finger protein 172
• RNF172E3 ubiquitin-protein ligase MARCH2

Background

MARCH2 - membrane-associated ring finger (C3HC4) 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MARCH2