MAPKAPK2 Antibody

Immunohistochemistry-Paraffin: MAPKAPK2 Antibody [NBP2-57197] - Immunohistochemical staining of human kidney shows moderate cytoplasmic and nuclear positivity in cells in tubules.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MAPKAPK2 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
• Predicted Species: Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAPKAPK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MAPKAPK2 Recombinant Protein Antigen (NBP2-57197PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MAPKAPK2 Antibody

• EC 2.7.11
• EC 2.7.11.1
• MAP kinase-activated protein kinase 2
• MAPK-activated protein kinase 2
• MAPKAP kinase 2
• MAPKAPK2
• MAPKAPK-2
• mitogen-activated protein kinase-activated protein kinase 2
• MK2
• Rps6kc1

Background

MAPKAP Kinase 2 encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAPKAPK2