MAPKAPK2 Antibody


Immunohistochemistry: MAPKAPK2 Antibody [NBP2-56233] - Immunohistochemical staining of human breast shows strong membranous and cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MAPKAPK2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QIFNKRTQEKFALKMLQDCPKARREVELHWRASQCPHIVRIVDVYENLYAG
Specificity of human MAPKAPK2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MAPKAPK2 Antibody

  • EC 2.7.11
  • EC
  • MAP kinase-activated protein kinase 2
  • MAPK-activated protein kinase 2
  • MAPKAP kinase 2
  • mitogen-activated protein kinase-activated protein kinase 2
  • MK2
  • Rps6kc1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for MAPKAPK2 Antibody (NBP2-56233) (0)

There are no publications for MAPKAPK2 Antibody (NBP2-56233).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAPKAPK2 Antibody (NBP2-56233) (0)

There are no reviews for MAPKAPK2 Antibody (NBP2-56233). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAPKAPK2 Antibody (NBP2-56233) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MAPKAPK2 Products

Bioinformatics Tool for MAPKAPK2 Antibody (NBP2-56233)

Discover related pathways, diseases and genes to MAPKAPK2 Antibody (NBP2-56233). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAPKAPK2 Antibody (NBP2-56233)

Discover more about diseases related to MAPKAPK2 Antibody (NBP2-56233).

Pathways for MAPKAPK2 Antibody (NBP2-56233)

View related products by pathway.

PTMs for MAPKAPK2 Antibody (NBP2-56233)

Learn more about PTMs related to MAPKAPK2 Antibody (NBP2-56233).

Research Areas for MAPKAPK2 Antibody (NBP2-56233)

Find related products by research area.

Blogs on MAPKAPK2

There are no specific blogs for MAPKAPK2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MAPKAPK2 Antibody and receive a gift card or discount.


Gene Symbol MAPKAPK2