Recombinant Human MAPK15 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAPK15 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 3 - 83 of Human MAPK15 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TVVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFREITLLQEFGDHPNIISLLDVIRAE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAPK15
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAPK15 Protein

  • EC 2.7.11
  • ERK-7
  • ERK7MAPK 15
  • ERK-8
  • ERK8EC 2.7.11.24
  • extracellular regulated kinase 8 delta
  • extracellular signal regulated kinase 8
  • Extracellular signal-regulated kinase 7
  • Extracellular signal-regulated kinase 8
  • MAP kinase 15
  • mitogen-activated protein kinase 15

Background

MAPK15 - mitogen-activated protein kinase 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2848
Species: Hu, Mu
Applications: WB, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF5626
Species: Hu
Applications: WB, ICC
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB3196
Species: Hu
Applications: WB, IHC
NBP2-45743
Species: Hu
Applications: WB, IHC, IF
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for MAPK15 Partial Recombinant Protein (H00225689-Q01) (0)

There are no publications for MAPK15 Partial Recombinant Protein (H00225689-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAPK15 Partial Recombinant Protein (H00225689-Q01) (0)

There are no reviews for MAPK15 Partial Recombinant Protein (H00225689-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAPK15 Partial Recombinant Protein (H00225689-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAPK15 Products

Bioinformatics Tool for MAPK15 Partial Recombinant Protein (H00225689-Q01)

Discover related pathways, diseases and genes to MAPK15 Partial Recombinant Protein (H00225689-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAPK15 Partial Recombinant Protein (H00225689-Q01)

Discover more about diseases related to MAPK15 Partial Recombinant Protein (H00225689-Q01).
 

Pathways for MAPK15 Partial Recombinant Protein (H00225689-Q01)

View related products by pathway.

PTMs for MAPK15 Partial Recombinant Protein (H00225689-Q01)

Learn more about PTMs related to MAPK15 Partial Recombinant Protein (H00225689-Q01).

Blogs on MAPK15

There are no specific blogs for MAPK15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MAPK15 Antibody
NBP1-56789

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAPK15 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK15