Home » MAP9 » MAP9 Antibodies » MAP9 Antibody

MAP9 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related MAP9 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-90842
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

MAP9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: STTLAYTKSPKVTKRTTFQDELIRAITARSARQRSSEYSDDFDSDEIVSLGDFSDTSADENSVNKKMNDFHISDDE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Publications
Read Publication using
NBP1-90842 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP9 Antibody

  • microtubule-associated protein 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(18 Publications)
Species: Hu
Applications: ELISA
Protein S/PROS1
Antibody [Unconjugate
AF4036
Western Blot Protein S/PROS1 Antibody [Unconjugated]
Simple Western Protein S/PROS1 Antibody [Unconjugated]
(7 Publications)
Species: Hu
Applications: Simple Western, WB
PSAT1 Antibody
NBP1-32920
Western Blot PSAT1 Antibody
Immunocytochemistry/ Immunofluorescence PSAT1 Antibody
Immunohistochemistry-Paraffin PSAT1 Antibody
(13 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB

Puromycin-sensitive am ...
NBP3-48658
Western Blot Puromycin-sensitive aminopeptidase/NPEPPS Antibody (HL1531)
Immunohistochemistry-Paraffin Puromycin-sensitive aminopeptidase/NPEPPS Antibody (HL1531)
Immunocytochemistry/ Immunofluorescence Puromycin-sensitive aminopeptidase/NPEPPS Antibody (HL1531)
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, WB
PLAG1 Antibody
(3B7) - Azide and BSA ...
H00005324-M02
Immunohistochemistry PLAG1 Antibody (3B7) - Azide and BSA Free
Immunohistochemistry PLAG1 Antibody (3B7) - Azide and BSA Free
ELISA PLAG1 Antibody (3B7) - Azide and BSA Free
(20 Publications)
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB

alpha-Methylacyl-CoA R ...
NBP1-87168
Immunohistochemistry-Paraffin alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free
Immunohistochemistry-Paraffin alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free
Immunohistochemistry-Paraffin alpha-Methylacyl-CoA Racemase/AMACR Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
Acinus Antibody -
BSA Free
NBP1-76855
Immunocytochemistry/ Immunofluorescence Acinus Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Acinus Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Acinus Antibody - BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
p63/TP73L Antibody
[Unconjugated]
AF1916
Immunohistochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry p63/TP73L Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]
(1 Review)
(24 Publications)
Species: Hu
Applications: ICC, IHC, WB
CKAP4/p63 Antibody
[Unconjugated]
AF7355
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
Western Blot CKAP4/p63 Antibody [Unconjugated]
Immunocytochemistry CKAP4/p63 Antibody [Unconjugated]
(4 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
RPE65 Antibody
(401.8B11.3D9) - BSA ...
NB100-355
Immunocytochemistry/ Immunofluorescence RPE65 Antibody (401.8B11.3D9) - BSA Free
Immunohistochemistry-Frozen RPE65 Antibody (401.8B11.3D9) - BSA Free
Western Blot RPE65 Antibody (401.8B11.3D9) - BSA Free
(7 Reviews)
(105 Publications)
Species: Bv, Ca, Ch, Hu, Mu, Po, Pm, Rt, Xp
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, IP, In vivo, KO, Simple Western, WB
UVRAG Antibody
NBP1-18885
Immunohistochemistry-Paraffin UVRAG Antibody
Western Blot UVRAG Antibody
Western Blot UVRAG Antibody
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, KO, WB
RNPS1 Antibody
(7G8) - Azide and BSA ...
H00010921-M05
Western Blot RNPS1 Antibody (7G8) - Azide and BSA Free
Western Blot RNPS1 Antibody (7G8) - Azide and BSA Free
Western Blot RNPS1 Antibody (7G8) - Azide and BSA Free
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
SAP18 Antibody -
BSA Free
NBP2-94893
Immunohistochemistry-Paraffin SAP18 Antibody - BSA Free
Western Blot SAP18 Antibody - BSA Free
Immunohistochemistry-Paraffin SAP18 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
PLK1 Antibody
(OTI1D4)
NBP1-48291
Western Blot PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
Immunohistochemistry-Paraffin PLK1 Antibody (OTI1D4)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
Aminopeptidase
A/ENPEP Antibody (6C3 ...
NBP2-80573
Flow Cytometry Aminopeptidase A/ENPEP Antibody (6C3) - Azide and BSA Free
Flow Cytometry Aminopeptidase A/ENPEP Antibody (6C3) - Azide and BSA Free
Species: Mu
Applications: CyTOF-ready, Flow, IHC,  IHC-P, IP
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(838 Publications)
Species: Hu
Applications: BA
SGSM3 Antibody -
BSA Free
NBP2-13304
Western Blot SGSM3 Antibody - BSA Free
Immunohistochemistry-Paraffin SGSM3 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
ASAH1 Antibody -
BSA Free
NBP1-89296
Immunohistochemistry-Paraffin ASAH1 Antibody - BSA Free
Immunohistochemistry-Paraffin ASAH1 Antibody - BSA Free
Immunohistochemistry-Paraffin ASAH1 Antibody - BSA Free
(7 Publications)
Species: Hu
Applications: IHC,  IHC-P, WB
Pinin Antibody -
BSA Free
NBP1-87784
Immunohistochemistry-Paraffin Pinin Antibody - BSA Free
Immunohistochemistry-Paraffin Pinin Antibody - BSA Free
Immunohistochemistry-Paraffin Pinin Antibody - BSA Free
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
APCDD1 Antibody -
BSA Free
NB110-92756
Western Blot APCDD1 Antibody - BSA Free
Western Blot APCDD1 Antibody - BSA Free
Western Blot APCDD1 Antibody - BSA Free
(3 Publications)
Species: Ch, Hu, Mu, Re
Applications: KD, WB

Publications for MAP9 Antibody (NBP1-90842)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IF/IHC.


Filter By Application
IF/IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MAP9 Antibody (NBP1-90842) (0)

There are no reviews for MAP9 Antibody (NBP1-90842). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAP9 Antibody (NBP1-90842) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP9 Products

Array NBP1-90842

Blogs on MAP9

There are no specific blogs for MAP9, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP9 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MAP9