MAP6 Antibody

Images

 
Immunohistochemistry: MAP6 Antibody [NBP2-14221] - Staining of human cerebellum shows strong cytoplasmic and nuclear positivity in Purkinje cells and cells in molecular layer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KGEGPIVPAPVKDEGPMVSAPIKDQDPMVPEHPKDESAMATAPIKNQGSM VSEPVKNQGLVVSGPVKDQDVVVPEHAKVHDSAVVAPVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAP6 Protein (NBP2-14221PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP6 Antibody

  • microtubule-associated protein 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB300-213
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr
AF3795
Species: Hu
Applications: WB, IP
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
AF5919
Species: Mu, Rt
Applications: WB, IHC, ICC
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
MAB6967
Species: Hu
Applications: WB
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32630
Species: Hu
Applications: IHC, IHC-P
NBP1-22568
Species: Hu
Applications: IHC-P
NBP1-89335
Species: Hu
Applications: WB, IHC, IHC-P
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, IF

Publications for MAP6 Antibody (NBP2-14221) (0)

There are no publications for MAP6 Antibody (NBP2-14221).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP6 Antibody (NBP2-14221) (0)

There are no reviews for MAP6 Antibody (NBP2-14221). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAP6 Antibody (NBP2-14221) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP6 Products

Bioinformatics Tool for MAP6 Antibody (NBP2-14221)

Discover related pathways, diseases and genes to MAP6 Antibody (NBP2-14221). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP6 Antibody (NBP2-14221)

Discover more about diseases related to MAP6 Antibody (NBP2-14221).
 

Pathways for MAP6 Antibody (NBP2-14221)

View related products by pathway.

PTMs for MAP6 Antibody (NBP2-14221)

Learn more about PTMs related to MAP6 Antibody (NBP2-14221).

Blogs on MAP6

There are no specific blogs for MAP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP6