MAP3K12 binding inhibitory protein 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MAP3K12 binding inhibitory protein 1 Antibody [NBP1-85805] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleus, nucleoli & cytosol.
Immunohistochemistry-Paraffin: MAP3K12 binding inhibitory protein 1 Antibody [NBP1-85805] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAP3K12 binding inhibitory protein 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DCNQENSCARTDAIFTPYPGFKSHVKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLEDKILELEGISPEYFQSVSFSGKRRKVQPPQQNY
Localization
nucleoli & cytoplasm
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MBIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MAP3K12 binding inhibitory protein 1 Protein (NBP1-85805PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAP3K12 binding inhibitory protein 1 Antibody

  • MAP3K12 binding inhibitory protein 1
  • MAP3K12-binding inhibitory protein 1
  • MAPK upstream kinase-binding inhibitory protein
  • MUK-binding inhibitory protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46063
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-83889
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP1-62178
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IP
AF4984
Species: Hu
Applications: WB, Simple Western, ChIP, CyTOF-ready, ICC, ICFlow
NB100-2439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
AF486
Species: Mu
Applications: WB, IHC, Neut
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NBP1-76962
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC
MAB8634
Species: Mu
Applications: WB, Simple Western, Flow, IHC
NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85805
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805) (0)

There are no publications for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805) (0)

There are no reviews for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAP3K12 binding inhibitory protein 1 Products

Bioinformatics Tool for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805)

Discover related pathways, diseases and genes to MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805)

Discover more about diseases related to MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805).
 

Pathways for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805)

View related products by pathway.

PTMs for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805)

Learn more about PTMs related to MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805).
 

Research Areas for MAP3K12 binding inhibitory protein 1 Antibody (NBP1-85805)

Find related products by research area.

Blogs on MAP3K12 binding inhibitory protein 1

There are no specific blogs for MAP3K12 binding inhibitory protein 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAP3K12 binding inhibitory protein 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MBIP
Entrez
Uniprot