Mammaglobin B Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SCGB2A1. Source: E. coli
Amino Acid Sequence: KLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
SCGB2A1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87736. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Mammaglobin B Recombinant Protein Antigen
Background
Secretoglobins (also called lipophilins or mammaglobins) are small secreted proteins of endocrine-responsive organs and mucosal epithelia that form multimeric complexes and correlate with the development of various human cancers. Lipophilin A and Lipophilin B are orthologs of prostatein (estramustine- binding protein), the major secretory glycoprotein of the rat ventral prostate gland. Lipophilin A, also designated LIPA, LPHA and secretoglobin, family 1D, member 1 (SCGB1D1), is a component of a heterodimeric molecule present in human tears. Lipophilin B, also designated LIPB, LPHB and secretoglobin, family 1D, member 2 (SCGB1D2), mRNA can be overexpressed in breast tumors and shows a high degree of correlation with the mRNA expression profile of mammaglobin. Histological detection in breast tissue of Mammaglobin A, also designated MGB1 and secretoglobin, family 2A, member 2 (SCGB2A2) and Mammaglobin B, also designated MGB2, Lipophilin C, LPHC, UGB3 and SCGB2A2, is a reliable diagnostic marker for breast tumors
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Mammaglobin B Protein (NBP1-87736PEP) (0)
There are no publications for Mammaglobin B Protein (NBP1-87736PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mammaglobin B Protein (NBP1-87736PEP) (0)
There are no reviews for Mammaglobin B Protein (NBP1-87736PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Mammaglobin B Protein (NBP1-87736PEP) (0)
Additional Mammaglobin B Products
Research Areas for Mammaglobin B Protein (NBP1-87736PEP)
Find related products by research area.
|
Blogs on Mammaglobin B