![Western Blot: MAK10 Antibody [NBP2-58424] - Analysis in human cell line RT-4 and human cell line U-251 MG.](http://images.novusbio.com/fullsize2/MAK10-Antibody-Western-Blot-NBP2-58424-img0002.jpg "Western Blot: MAK10 Antibody [NBP2-58424] - Analysis in human cell line RT-4 and human cell line U-251 MG.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: DDDDSGWELSMPEKMEKSNTNWVDITQDFEEACRELKLGELLHDKLFGLFEAMSAIEMMDPKMDAGMIGNQVNRKVL |
| Predicted Species | Mouse (92%), Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NAA35 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
-Immunohistochemistry-Paraffin-H00057538-M01-img0005.jpg)
-Immunocytochemistry-Immunofluorescence-H00057538-M01-img0003.jpg)
-Western-Blot-NBP2-45723-img0001.jpg)
-Immunohistochemistry-Paraffin-NBP2-45723-img0002.jpg)
-Immunohistochemistry-Paraffin-NBP2-45723-img0003.jpg)
-Dual-RNAscope-ISH-IHC-NBP2-29429-img0015.jpg)
-CyTOF-reported-NBP2-29429-img0016.jpg)
-Flow-Cytometry-NBP2-29429-img0004.jpg)
-Immunohistochemistry-NBP2-46542-img0001.jpg)
-Immunohistochemistry-NBP2-46542-img0002.jpg)
-Immunohistochemistry-NBP2-46542-img0003.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
JIHYE PAIK |
ICC | Human | 12/30/2019 |
Summary
|
||||||||
Enlarge |
reviewed by:
JIHYE PAIK |
WB | Human | 12/30/2019 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Diseases for MAK10 Antibody (NBP2-58424)Discover more about diseases related to MAK10 Antibody (NBP2-58424).
| Pathways for MAK10 Antibody (NBP2-58424)View related products by pathway.
|
PTMs for MAK10 Antibody (NBP2-58424)Learn more about PTMs related to MAK10 Antibody (NBP2-58424).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| JIHYE PAIK 12/30/2019 |
||
| Application: | ICC | |
| Species: | Human |
| JIHYE PAIK 12/30/2019 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | NAA35 |
![Immunocytochemistry/Immunofluorescence: MAK10 Antibody [NBP2-58424] - Paraformaldehyde (4%) fixed HeLa cells were stained with anti-Mak10 antibody and Alexa Fluor 488 anti-rabbit secondary antibody. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/fullsize2/MAK10-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58424-img0003.jpg "Immunocytochemistry/Immunofluorescence: MAK10 Antibody [NBP2-58424] - Paraformaldehyde (4%) fixed HeLa cells were stained with anti-Mak10 antibody and Alexa Fluor 488 anti-rabbit secondary antibody. ICC/IF image submitted by a verified customer review.")
![Immunocytochemistry/Immunofluorescence: MAK10 Antibody [NBP2-58424] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/MAK10-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-58424-img0001.jpg "Immunocytochemistry/Immunofluorescence: MAK10 Antibody [NBP2-58424] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green. Antibody staining is shown in green.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
