MAGOH Antibody

Images

 
Western Blot: MAGOH Antibody [NBP2-46689] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MG
Immunohistochemistry: MAGOH Antibody [NBP2-46689] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGOH Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHIS
Specificity
Specificity of human, mouse, rat MAGOH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGOH
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGOH Recombinant Protein Antigen (NBP2-46689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGOH Antibody

  • MAGOHAMAGOH1
  • mago-nashi (Drosophila) homolog, proliferation-associated
  • mago-nashi homolog, proliferation-associated (Drosophila)
  • protein mago nashi homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30321
Species: Hu
Applications: WB (-), IHC, IHC-P, IP
NBP1-85268
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33598
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-92343
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57160
Species: Hu
Applications: WB, IHC, IHC-P, KD
H00055110-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-83134
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20813
Species: Hu, Mu
Applications: WB, ICC/IF
NB100-368
Species: Hu
Applications: WB
H00065110-M06
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-90286
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38401
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76869
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC, IF
NBP2-58594
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13381
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87769
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58599
Species: Hu
Applications: ICC/IF

Publications for MAGOH Antibody (NBP2-46689) (0)

There are no publications for MAGOH Antibody (NBP2-46689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGOH Antibody (NBP2-46689) (0)

There are no reviews for MAGOH Antibody (NBP2-46689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGOH Antibody (NBP2-46689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MAGOH Antibody (NBP2-46689)

Discover related pathways, diseases and genes to MAGOH Antibody (NBP2-46689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGOH Antibody (NBP2-46689)

Discover more about diseases related to MAGOH Antibody (NBP2-46689).
 

Pathways for MAGOH Antibody (NBP2-46689)

View related products by pathway.

PTMs for MAGOH Antibody (NBP2-46689)

Learn more about PTMs related to MAGOH Antibody (NBP2-46689).

Blogs on MAGOH

There are no specific blogs for MAGOH, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGOH Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGOH
Entrez
Uniprot