Magmas Antibody - BSA Free

Western Blot: Magmas Antibody [NBP3-03573] - Analysis of extracts of various cell lines, using Magmas antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Magmas Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Magmas Antibody - BSA Free (NBP3-03573) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-125 of human Magmas (NP_057153.8). ARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PAM16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 13 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Magmas Antibody - BSA Free

• MAGMAS
• mitochondria associated protein involved in granulocyte macrophage colonystimulating factor signal transduction
• Mitochondria-associated granulocyte macrophage CSF-signaling molecule
• mitochondrial import inner membrane translocase subunit TIM16
• presequence translocase-associated motor 16 homolog (S. cerevisiae)
• Presequence translocated-associated motor subunit PAM16
• Tim16
• TIMM16magmas-like protein

Background

Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May be required to regulate the ATP-dependent activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PAM16