Recombinant Human MAGI1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MAGI1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 761-859 of Human MAGI1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAGI1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MAGI1 Protein

  • AIP-3
  • AIP3WW and PDZ domain-containing protein 1
  • membrane associated guanylate kinase, WW and PDZ domain containing 1
  • TNRC19BAP-1
  • WWP3WW domain-containing protein 3

Background

MAGI1 - membrane associated guanylate kinase, WW and PDZ domain containing 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF6008
Species: Hu, Mu, Rt
Applications: WB
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-68209
Species: Hu, Mu
Applications: WB, IP, PLA
NBP2-17210
Species: Hu
Applications: WB, ICC/IF, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-06549
Species: Hu, Mu
Applications: IP (-), WB, IHC-P
AF3159
Species: Mu
Applications: WB, IHC

Publications for MAGI1 Partial Recombinant Protein (H00009223-Q01) (0)

There are no publications for MAGI1 Partial Recombinant Protein (H00009223-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGI1 Partial Recombinant Protein (H00009223-Q01) (0)

There are no reviews for MAGI1 Partial Recombinant Protein (H00009223-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MAGI1 Partial Recombinant Protein (H00009223-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MAGI1 Products

Bioinformatics Tool for MAGI1 Partial Recombinant Protein (H00009223-Q01)

Discover related pathways, diseases and genes to MAGI1 Partial Recombinant Protein (H00009223-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MAGI1 Partial Recombinant Protein (H00009223-Q01)

Discover more about diseases related to MAGI1 Partial Recombinant Protein (H00009223-Q01).
 

Pathways for MAGI1 Partial Recombinant Protein (H00009223-Q01)

View related products by pathway.

PTMs for MAGI1 Partial Recombinant Protein (H00009223-Q01)

Learn more about PTMs related to MAGI1 Partial Recombinant Protein (H00009223-Q01).
 

Research Areas for MAGI1 Partial Recombinant Protein (H00009223-Q01)

Find related products by research area.

Blogs on MAGI1

There are no specific blogs for MAGI1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

p19ARF Antibody
NB200-106
MAGI1 Antibody (7B4)
H00009223-M03

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MAGI1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGI1