MAGEC3 Antibody

Images

 
Immunohistochemistry-Paraffin: MAGEC3 Antibody [NBP2-14757] - Staining of human bone marrow shows strong cytoplasmic positivity in hematopoietic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MAGEC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRLDEE SSSEE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MAGEC3 Protein (NBP2-14757PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MAGEC3 Antibody

  • CT7.2
  • HCA2
  • MAGEC3 melanoma antigen family C, 3
  • MAGE-C3
  • MAGEC4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP1-92180
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NLS2095
Species: Hu, Mu
Applications: IHC, IHC-P
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-01346
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88031
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54435
Species: Hu
Applications: WB, Flow, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-14757
Species: Hu
Applications: IHC, IHC-P

Publications for MAGEC3 Antibody (NBP2-14757) (0)

There are no publications for MAGEC3 Antibody (NBP2-14757).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MAGEC3 Antibody (NBP2-14757) (0)

There are no reviews for MAGEC3 Antibody (NBP2-14757). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MAGEC3 Antibody (NBP2-14757) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MAGEC3 Products

MAGEC3 NBP2-14757

Bioinformatics Tool for MAGEC3 Antibody (NBP2-14757)

Discover related pathways, diseases and genes to MAGEC3 Antibody (NBP2-14757). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MAGEC3

There are no specific blogs for MAGEC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MAGEC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEC3